[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bggA.bssp"
#ERROR : Can't open dsspfile "3c65A.bssp"
#ERROR : Can't open dsspfile "2csdA.bssp"
#ERROR : Can't open dsspfile "1bgxT.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "1cmwA.bssp"
#ERROR : Can't open dsspfile "1bvsB.bssp"
#ERROR : Can't open dsspfile "1bvsA.bssp"
#ERROR : Can't open dsspfile "1cukA.bssp"
#ERROR : Can't open dsspfile "1dgtB.bssp"
#ERROR : Can't open dsspfile "2bhnB.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "2bhnC.bssp"
#ERROR : Can't open dsspfile "1c7yA.bssp"
#ERROR : Can't open dsspfile "1d8lA.bssp"
#ERROR : Can't open dsspfile "2a1jB.bssp"
#ERROR : Can't open dsspfile "3c5nA.bssp"
#ERROR : Can't open dsspfile "3bz1U.bssp"
#ERROR : Can't open dsspfile "1bqqT.bssp"
#ERROR : Can't open dsspfile "2a1jA.bssp"
#ERROR : Can't open dsspfile "1b22A.bssp"
#ERROR : Can't open dsspfile "2duyA.bssp"
#ERROR : Can't open dsspfile "3egaA.bssp"
#ERROR : Can't open dsspfile "1cooA.bssp"
#ERROR : Can't open dsspfile "2eduA.bssp"
#ERROR : Can't open dsspfile "2axtU.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"

## Summary of PDB Search
:656
    3e-54   7%  2bggA  [x.x.x] PROTEIN AF1318
    1e-42  40%  3c65A  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-31  11%  2csdA  [x.x.x] TOPOISOMERASE V
    3e-31  14%  1bgxT  [c.120.1 - a.60.7 - c.55.3 - e.8.1] TAQ DNA POLYMERASE
    2e-30  19%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
    6e-28  13%  2csbA  [x.x.x] TOPOISOMERASE V
    4e-26  17%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    6e-25  15%  1cmwA  [c.120.1 - a.60.7 - c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE
    1e-21  24%  1bvsB  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
    1e-21  23%  1bvsA  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
    2e-21  19%  1cukA  [x.x.x] RUVA PROTEIN
    2e-21  16%  1dgtB  [x.x.x] DNA LIGASE
    2e-21  19%  2bhnB  [x.x.x] XPF ENDONUCLEASE
    5e-21  15%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    2e-20  18%  2bgwA  [x.x.x] XPF ENDONUCLEASE
    2e-19  19%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    5e-19  18%  2bhnC  [x.x.x] XPF ENDONUCLEASE
    5e-19  20%  1c7yA  [b.40.4 - a.60.2 - a.5.1] HOLLIDAY JUNCTION DNA HELICASE RUVA
    3e-18  20%  1d8lA  [b.40.4 - a.60.2] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE
    1e-13  21%  2a1jB  [x.x.x] DNA EXCISION REPAIR PROTEIN ERCC-1
    3e-11  20%  3c5nA  [x.x.x] TUBBY-RELATED PROTEIN 1
    4e-11  18%  3bz1U  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    9e-11  13%  1bqqT  [b.40.3] METALLOPROTEINASE INHIBITOR 2
    2e-10  21%  2a1jA  [x.x.x] DNA REPAIR ENDONUCLEASE XPF
    3e-10  20%  1b22A  [a.60.4] DNA REPAIR PROTEIN RAD51
    3e-09  29%  2duyA  [x.x.x] COMPETENCE PROTEIN COMEA-RELATED PROTEIN
    1e-08  12%  3egaA  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    2e-08  22%  1cooA  [x.x.x] RNA POLYMERASE ALPHA SUBUNIT
    3e-08  11%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
    6e-08  14%  2axtU  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    4e-05  22%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           -------------------------------IVIRAKAVNKKEVDSGNDIY---GNPIKRIQYEIKQI-K
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           HDGLTTNGVLVHPRESQPGVWREISVCGDVYTLRETRSAQQRGKVESETNVLQDGSLIDLCGATLLWR--
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ---GLTTNGVLVMHPRQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLLCGATLLWRTADGLFHT


                         .         .         *         .         .         .         .:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           MFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEY----LIAGKAEGNGNMHITLC----DFIVPWDTLSAT
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           PTQKHIEALRQE----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bggA           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           QKK---SLNHRYQMGCECKIT---RCPMIPCYISSPDEC-------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxIRDDIQALRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGR
2bggA           ----------------------PISNTGELIKGLRNYGPYEVPSLKYNQIALINQLKSQISSKIDEVWHI
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVD
2bggA           HNINISEFIYDSPHFDS---IKSQVDNAID------TGVDGIMLVLPEYNTPLYYKLKSYLI--NSIPSQ
3c65A           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
1bgxT           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csbA           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
1cmwA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKXXXXXXXXXXXXXXPLRIECFDISTLQGEH
2bggA           FMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKG-------------SDIIIGTGATRIDNVN
3c65A           ------------------------------------------------------PRRIEAFDNSNIYGAD
2csdA           IVEHKRDIMRRYLEQRIVECALKLQDRYGIREDVALCLARAF------------DGSISMIATTPYRTKD
1bgxT           ------------------------------------------------------AVYGFAKSLLKALKED
1dgsA           ------------------------------------------------------HCYEKALGAEGVEEPF
2csbA           --------TRRWIVEHKRDIRRYLEQRIVECALKL--------QDRYGIREDVALCLARAFDGSISIATT
2bhnA           ----------------------------------------------------------------------
1cmwA           ------------------------------------------------------AVYGFAKSLLKALKED
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           ------------------------------------------------------HCYEKALGAEGVEEPF
2bhnB           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2bgwA           -----------------------------------------------------------------MLEDP
2bgwB           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
2bggA           LFCFAMVFKKDGTMLWNEISPIVTSSEYLT-YLKSTIKKVVYGFKKSNPD--------------------
3c65A           PVSALVVFLDGKPAKKEYRKYKVKTVAGPN-DYETR-EVVRRRYTRVLKE--------------------
2csdA           VCPDLTLEEAKSVNRTLATLIDEHG--LSPDAADELIEHFESIAGIL-----------------------
1bgxT           GDAVIVVFDAKAFRHEAYGGYKAGRAPTPE-DFPRQLALIKELVDLL-----------------------
1dgsA           EADGVVLKLDDLT-LWGELGYTARAPRFALKFPAEEKETRLLDVVFQVGRTGRV----------TPVGV-
2csbA           PYRTLKDVCPDLTL--EEAKSVNRTLATLI-DEHGLSPDAADELIE-----------------------H
2bhnA           -RVYVDVREERSPVPSILESLGVQVIP---KQLPMGDYLVSDSIIVERKTSSDFAK-------------S
1cmwA           GDAVIVVFDAKSFRHEAYGGYKAGRAPTPE-DFPRQLALIKELV--------------------------
1bvsB           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dgtB           EADGVVLKLDDLT-LWGELGYTARAPRFALKFPAEEKETRLLDVVFQVGRTGRVTPVGVLE---------
2bhnB           -RVYVDVREERSPVPSILESLGVQVIPK---QLPMGDYLVSDSIIVERKTSSD-----------------
3c1yA           ----------------------------------------------------------------------
2bgwA           GGRPRVYVEERSPVPSILESLGV---QVIPKQLPMGDYLVSDSIIVERKT------SSDFAKSLFDGRFE
2bgwB           ---PRVYVDVREERPSILESLGVQVIP---KQLPMGDYLVSDSIIVERKT--------------------
2bhnC           ------VREERSPVPSILESLGVQQLPMGD-YLVSDSIIVERKTS-------------------------
1c7yA           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
3c5nA           ----------------------------------------------------------------------
3bz1U           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
2bggA           --------WDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQDVKYAILHLNETHPFWVMEGTKVKLSS
3c65A           -----GLPLPDLIIIDGGKGHLSAVRDVLENELGLDVPLAGLSELL----AGDPPDVVPLDRQSQEFYLL
2csdA           --------ATDLEEIERMYEEGRLSEEAYRAAVEIQLAELTKKEGVGRKTAERLLRAFGNPERVKQLARE
1bgxT           -------GLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLL----SDRIHVLHPEGYLITP
1dgsA           ---------LEPVFIEGSEVSRVTLHNESYDIRIGDWVLVHKAGGVIPERRTGKERPIRWPEACPECGHR
2csbA           FESIAGILATDLEEIERYEEGRLSEEAYRAAVEIQLKEGVGRKTAERLLRAFGNPERVKQLAREFEIEKL
2bhnA           LFDGRLFEQASRLAEHYETVFIIVEGPPVPRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTALVIESL
1cmwA           ----DLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDR----IHVLHPEGYLITP
1bvsB           --------------IFSVRGEVLEVA--------LDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTA
1bvsA           --------------IFSVRGEVLEV---ALDHAVIEAAGIG-----YRVNATPSALATLNQGSQARLVTA
1cukA           --------------IGRLRGIIIEKQPPLVLI---EVGGVGY----EVHMPMTCFYELPEAGQEAIVFTH
1dgtB           --------PVFIEGSEVSRVTLHNESYIEEDIRIGDWVLVHKAGGVIPERRTGKERPIRWPEACPECGHR
2bhnB           ---------FAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRGRERSLYAAMAALQLDYGIRLMNTM
3c1yA           -----------------------------------------------MDYSSEEVEEETAQNILQDFITR
2bgwA           QASRLAEHYETVFIIVEGPPVPRRYRGRERSL-YAAMAALQLDYGIRLMNTMDPKGTALV------IESL
2bgwB           -----SSDFAKSLFDGRLFEQASRLAEHYETVFI-IVEGPPVPRR-YRGRERSLYAAMAALQLDYGIRLM
2bhnC           ---------SDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRRSLYAAMAALQLDYGIRLMNT
1c7yA           --------------IGRLRGIIIEKQPPLVLIEVGGVG--------YEVHMPMTCYELPEAGQEAIVFTH
1d8lA           --------------IGRLRGIIIEKQPPLVLIEVGGVG--------YEVHMPMTCFELPEAGQEAIVFTH
2a1jB           ----------------------------------------------------------------------
3c5nA           ---------------------------------------------------PAPQGRTVLTRDKMYPSYF
3bz1U           ----------------------------------------------------------------------
1bqqT           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
3egaA           ----------------------------------------------------------------------
1cooA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT
2bggA           KRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKM-NWRGFRSRNLPVTVNYPKLV
3c65A           QRIQDEVHRFAV----------------------------------------------------------
2csdA           FEIEKLASVEGVGERVLRSLVPGY-ASLISIRGIDRERAERLLKKYGGYSKVREAGVEELR-EDGLTDAQ
1bgxT           AWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAH
1dgsA           LVKEGKVHRCPNPLCPAKRFEAIRHYAAMDIEGLGEKLIERLLEKVRDVADLYHLRKEDLLGLERMGEKS
2csbA           ASVEGVGERVLRSLVPGY-------ASLISIRGIDRERAERLLKKYGGYSKVREAGVEEL-REDGLTDAQ
2bhnA           ARLSTREGGQRIVIHKKPRLSDVREWILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
1cmwA           AWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNL-DRLKPA--IREKI
1bvsB           MVVREDSMTLYGFSDAENRDL---FLALLSVSGVGPRLAMATLAVHDARQALADSDVASLTRVPGIGRRG
1bvsA           MVVREDSMTLYGFSDAENRDLFL---ALLSVSGVGPRLAMATLAVHALRQALADSDVASLTRVPGIGRRG
1cukA           FVVREDAQLLYGFNNKQERTLFKE---LIKTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKT
1dgtB           LVKEGKVHRCPNPLCPAKRFEAIHLRKLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVL
2bhnB           DPKGTALSLARLSTRRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
3c1yA           REPSPISISRVLGYDVQQAAQLDGYRLLKTVARIPLSIGYNVVRMFKTLDQISKASVEDLKKVEGIGEKR
2bgwA           ARLSTREGGQRIVIHKKPRLSDWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bgwB           NTMDPKGTALVIESLARLSTKPRLSDVLQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bhnC           MDPKGTALVIESLARLSSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
1c7yA           FVVREDAQLL---YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKT
1d8lA           FVVREDAQLLYGFNNKQERTLFKE---LIKTNGVGPKLALAILSGMSAVNAVEREEVGALVKLPGIGKKT
2a1jB           ----------LLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQK
3c5nA           LHLDTEKKVFLLAGRKRKRSKTALISIDPTNNFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQEL
3bz1U           ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPY------ESVEDVLNIPGLTERQ
1bqqT           ----------------------------------------------------------------------
2a1jA           -------------------------DFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILG-NAAN
1b22A           -----------------EESFGPQPISRLEQCGINANDVKKLEEAFHTVEAVAYAPKKELINIKGISEAK
2duyA           ------------------------------LPGIGPVLARRIVEGRPY------ARVEDLLKVKGIGPAT
3egaA           ----------------------------------------------------------------------
1cooA           -----------------------------DDLELTVRSANCLKAEIHYIGDLVQRTEVELLKTPNLGKKS
2eduA           -----------------------SARDLRSLQRIGPKKAQLIVGWRELHGPFS--QVEDLERVEGITGKQ
2axtU           EELVNVVDEKLGTAYGEKIDLNTNIAAFIQYRGLYPTLAKLIVKNAP------YESVEDVLNIPGLTERQ
3egbB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AQTIYERLTSVEGGQRTQPExxxxxx
2bggA           AGIIAN--------------------
3c65A           --------------------------
2csdA           IRELKG--------------------
1bgxT           MDDLK---------------------
1dgsA           AQNLLRQI------------------
2csbA           IRELKG--------------------
2bhnA           AEEIKKIL------------------
1cmwA           LAHMDD--------------------
1bvsB           AERIVLEL------------------
1bvsA           AERIVLELADKV--------------
1cukA           AERLIVEM------------------
1dgtB           ARNLARRFGTMD--------------
2bhnB           AEEIKKIL------------------
3c1yA           ARAISESI-SSLKHRKT---------
2bgwA           AEEIKKIL------------------
2bgwB           AEEIKKIL------------------
2bhnC           AEEIKKIL------------------
1c7yA           AERLIVEM------------------
1d8lA           AERLIVEM------------------
2a1jB           ARRLFDVL------------------
3c5nA           AAVIYET-------------------
3bz1U           KQILRENLE-----------------
1bqqT           --------------------------
2a1jA           AKQLYDFI------------------
1b22A           ADKILAEA------------------
2duyA           LERLRPYL------------------
3egaA           --------------------------
1cooA           LTEIKDVL------------------
2eduA           MESFLKANILGLAAGQ----------
2axtU           KQILRENL-EHFTVTEVETA------
3egbB           --------------------------