[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56085.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2deuA.bssp"
#ERROR : Can't open dsspfile "2derA.bssp"
#ERROR : Can't open dsspfile "2dppB.bssp"
#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "2e21A.bssp"
#ERROR : Can't open dsspfile "2e21B.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "2e89D.bssp"
#ERROR : Can't open dsspfile "3b9xC.bssp"
#ERROR : Can't open dsspfile "3dlaA.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "3b9xD.bssp"
#ERROR : Can't open dsspfile "1b97A.bssp"
#ERROR : Can't open dsspfile "1ee1B.bssp"
#ERROR : Can't open dsspfile "2detA.bssp"
#ERROR : Can't open dsspfile "3dpiA.bssp"
#ERROR : Can't open dsspfile "3bl5E.bssp"
#ERROR : Can't open dsspfile "3bl5A.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "2d13C.bssp"
#ERROR : Can't open dsspfile "3dpiB.bssp"
#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "3b9xA.bssp"
#ERROR : Can't open dsspfile "2d13B.bssp"
#ERROR : Can't open dsspfile "2derB.bssp"
#ERROR : Can't open dsspfile "2d13D.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "2d13A.bssp"
#ERROR : Can't open dsspfile "1bd9A.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "1a44A.bssp"

## Summary of PDB Search
:399
    2e-41  16%  2deuA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    7e-36  16%  2derA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    3e-33  13%  2dppB  [x.x.x] NITRILE HYDRATASE BETA SUBUNIT
    5e-31  10%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    4e-30  13%  2e21A  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    2e-28  13%  2e21B  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    4e-26  15%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-26  12%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-25  13%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    3e-24  12%  2e89D  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    7e-24  12%  3b9xC  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-23  13%  3dlaA  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-22  15%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    7e-20  11%  3b9xD  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    7e-20   6%  1b97A  [c.52.1] RESTRICTION ENDONUCLEASE ECORV
    9e-18  16%  1ee1B  [c.26.2] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    1e-17  19%  2detA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    3e-17  18%  3dpiA  [x.x.x] NAD+ SYNTHETASE
    5e-16  14%  3bl5E  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    6e-16  15%  3bl5A  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    2e-15  16%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    9e-15  15%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    1e-14  16%  2d13C  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-13  20%  3dpiB  [x.x.x] NAD+ SYNTHETASE
    2e-13  12%  2ahjB  [b.34.4] NITRILE HYDRATASE
    1e-12  15%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    1e-12  14%  3b9xA  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    3e-12  18%  2d13B  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    6e-12  19%  2derB  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    1e-11  24%  2d13D  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-11  11%  2ahjD  [b.34.4] NITRILE HYDRATASE
    2e-11  19%  2d13A  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    4e-09  18%  1bd9A  [b.17.1] PHOSPHATIDYLETHANOLAMINE BINDING PROTEIN
    2e-08  21%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    7e-04  25%  1a44A  [x.x.x] PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN
:399

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
2deuA           --KKVIVGMSGGVDSSVS-AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAIELHTVNFAAEYWD
2derA           --KKVIVGMSGGVDSSVS-AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAIELHTVNFAAEYWD
2dppB           ----------------------------------------------------------------------
3dlaB           DYPKVVIGVSGGLDSTHAL-IVATHAMDREGRPRSDILAFALPGKNNAIKLARALGVTFSEIDIGDTA--
2e21A           --RRVLIAFSGGVDSVVLTDVLLKL-KNYFSLKEVALAHFNHMLRESAERDEE------FCKEFAKERNM
2e21B           --RRVLIAFSGGVDSVVLTDVLLKL-KNYFSLKEVALAHFNHMLRESAERDE------EFCKEFAKERNM
2dplB           --SKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNGFLRKGEPEFVVKTFRDEFGMNLHYVDAQDRFFS
3dlaC           --PKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFLPGFKNNAIKLARALGVTFSEI-DIGDTARL
3dlaD           --PKVVIGVSGGLDSTHAL-IVATHAMDREGRPRSDILAALPGFNNAIKLARALGVSEIDIGDTARLMLH
2e89D           --RRVLIAFSGGVDSVVLT-DVLLKLKNYFSLKEVALAHFNHMLRESAERDEE------FCKEFAKERNM
3b9xC           ---KIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQDKTLINGLNVCQKLEINVPVYAGMPQPIMR
3dlaA           DYPKVVIGVSGGLDSTHAL-IVATHAMDREGRPRSDILAFGHTKNNAIKLARALGFSEIDIGDTARLMLH
2c5sA           ---KVMVLLSGGIDSPVAA-YLTMKRGVSVEAVHFHSPPFTRAKQKVIDLAQELTKYCKRVTLHLVPF--
3b9xD           ---KIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNLDKTLINGLNVCQKLENVPVYAGMPQPIMRQ
1b97A           --KYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRP------IINKIAEKHGYIVEEPKQLNHYPDFTLY
1ee1B           --KGFVLGISGGQDSTLAGRLAQLSIREEGGDAQFIAVRLPHG-EDDAQLALKFIKPDKSWKFDIKSTVS
2detA           ---KVIVGMSGGVDSSVSA-WLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAIELHTVNFAAEYWD
3dpiA           GLRACVLGISGGIDSSTAG-RLAQLAVERLRASGYDARFVAAEADARRALAFVRA-DETLTVDVKP--AA
3bl5E           --EKAIVVFSGGQDSTTCL-LWALKEFEEVETVTFHYNQRHQEVEVAKSIAEKLGVKNHLLDMSLLNQLA
3bl5A           --EKAIVVFSGGQDSTTCL-LWALKEFEEVETVTFHYNQRHQEVEVAKSIAEKLGVKNHLL----DMSLL
3a4iA           -DSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLREPEFVVKTFRDEFGMNLHYV------DAQ
2dplA           --SKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFR----DEFGMNLHYVDAQ
2d13C           --ADVAVLYSGGKDSNYAL-YWALKSGLRVRYLVSMVSEELTSL-----------QARALGIPIIKGFTK
3dpiB           GLRACVLGISGGIDSSTAG-RLAQLAVERLRASGYDARFGAQEADARRALAFVRA-DETLTVDVKP--AA
2ahjB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3b9xA           ---KIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQDKTLINGLNVCQKLE-INVPVYAGMPQPIM
2d13B           --ADVAVLYSGGKDSNYAL-YWALKSGLRVRYLVSM---VSENVELTSLQARALG-IPIIKGFTEVEDLK
2derB           ---KVIVGMSGGVDSSVS-AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAIELHTVNFAAEYWD
2d13D           ---DVAVLYSGGKDSNYAL-YWALKSGLRVRYLVSMV-----SLTSLQARALGIPIIKGFTVEDLKNVLE
2ahjD           ----------------------------------------------------------------------
2d13A           --ADVAVLYSGGKDSNYAL-YWALKSGLRVRYLVSMVSE--NNVELTSLQARALGIPIIKGFTEKEKEVE
1bd9A           ----------------------------------------------------------------------
2e18A           ----VVIGISGGVDSATVAYLATKALGKEVLGLIMPYFE-NKDVEDAKLVAEKLG------IGYKVINIK
1a44A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
2deuA           NVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGRLLRGLDSNKDQSYFLYTLSHEQ
2derA           NVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGRLLRGLDSNKDQSYFLYTLSHAQ
2dppB           ----------------------------------------------------------------------
3dlaB           ------RLMLHTIGHVTF--ENVQAGLRTDYLFRIANQRGGIVLGTG----DLSELALGWSTYGVGDQMS
2e21A           KIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATA--HHLNDLLETSLLFFTRGTGLD
2e21B           KIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATA--HHLNDLLETSLLFFTRGTGLD
2dplB           ALKGVTDPEEKRKII---------GRVFIEVFEEVAKKIGAEYLIQGTILLYKDEVRELAKFLGLPEKIY
3dlaC           MLHTIGHPYSVGEKVYDVTFENVQAGLRTDYLFRIANQRGGIVLGTGD----LSELALGWSTYGVGDQMS
3dlaD           TIGHPYSVGEKVYDVTF---ENVQAGLRTDYLFRIANQRGGIVLGTG----DLSELALGWSTYGVGDQMS
2e89D           KIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSLLFFTRGTFLPKE
3b9xC           QQIVATGLDGPVFEPLTRQAESTHAVKYIIDTLMASD-GDITLVPVGPLSLPKIREIVLMGGAYGTGNFT
3dlaA           TIGHDVTFENVQAGLRT------------DYLFRIANQRGGIVLGTG----DLSELALGWSTYGVGDQMS
2c5sA           ----TEVQKTINKEIPSSYSMTVMRRMMMRITERIAEERNALAITTGSLGQVASQTLDSMHTINEVTNYP
3b9xD           QIVAIHGDTGLDGPVFEPLTRQAESTHAVKYIIDTLMASDGDITLVPVGPLSNIAVAMEIVLMGGAYGTG
1b97A           KPSEPNKKIAIDIKTTYTNKENEKIKLGGYTSFIRNNTKNIVYPFDQIIGYVYTRVATRKSSLKTYNINE
1ee1B           AFSDQYQQETGDQLTDFNKGNVK-ARTRMIAQYAIGGQEGLLVLGTGFFTKYGDGGADLLPLTGLTKRQE
2detA           NVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGRLLRGLDSNKDQSYFLYTLSHAQ
3dpiA           DAMLAALAAGGLYLDHDFVLGNIKARERMIAQYAVAGARNGVVIGTD-----HAAESVMGFFTKFGDGGA
3bl5E           PNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCETD--FSGYPDCRDEFVKSCNVTVNLAMEKPFV
3bl5A           NQLAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITG--VCEGYPDCRDEFVKSCNVTVNLAMEKPFV
3a4iA           DRFFSALKGVTDPEEKRK----IIGRVFIEVFEEVAKKIGAEYLIQGTI--APNLKLIE-----------
2dplA           DRFFSALKGVTDPEEKRK----IIGRVFIEVFEEVAKKIGAEYLIQGTIAPLNDEVRELAKFLGLPEKIY
2d13C           KEVEDLKNVLEGLKVDGIVAGALASRYQKERIENVARELGLKVYTPAW---EKDPYQYMLEIIKLGFK-V
3dpiB           DAMLAALAAGGLYLDHQQDFVLIKARERMIAQYAVAGARNGVVIGTD--HAAESVMGA------------
2ahjB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3b9xA           RQQIVADNIHGDTGLDGPVFEPLTRQAEVKYIIDTLMASDG-DITLVPVGPLSNIAVAMRMQPAILPKIR
2d13B           NVLEGLKVDGIVAGAQKERIENVARELGLKVYTPAPYQYMLEIIKLGF-----KVVFVAVSAYGLNESW-
2derB           NVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGRLLRGLDSNKDQSYFLYTLSHAQ
2d13D           GLKVDGIVAGALASR-------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
2d13A           DLKNVLEG----LKVDGIVAGALASRYQKERIENVARELGLKVYT---PAWEKDPY--------------
1bd9A           ---------------------------LVVNMKGNDISSGTVLSDYVGSGKGTGLHRYVWLVYEQDRPLK
2e18A           PIVDSFVENLELNLDRKGLGNIMSR-TRMIMLYAHANSLGRIVLGTS------NRSEFLTGYFTKWGDGS
1a44A           -----------------------------------------------GPPKGTGLHRYVWLVYEQEGPLK


                         +         .         .         .         .         *         .:210
query           VLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYDYTQNPAE
2deuA           IAQSLFPGELEKPQVRKIAEDLGLVTAKK---KDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIE
2derA           SLFPVGE--LEKPQVRKIAEDLGLVKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGTKEG
2dppB           ----------------------------------------------------------------------
3dlaB           HYNVNAG--VPKTLIQHLIRWVISAGEFGEKVGE-VLQSVLDTEITSEAKVGPFALQDFSLFQVLRYGFR
2e21A           GLIGFLPKEVKRSEIEEYAKFKGLRWVEDETNYE---VSIPRNRIRHRVIPELKRINENLEDTFLKMVEE
2e21B           GLIGFLPKEVKRSEIEEYAKFKGLRWVED---ETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVEE
2dplB           NRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGLR-----------PWQAFAVLLGVKTVGV
3dlaC           HYNVNAG--VPKTLIQHLIRWVISAGEFGEKVPFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNW
3dlaD           HYNVNAG--VPKTLIQHLIRWVISAGEFG-EKVGEVLQSVLDTEEAKVGPFALQDFSLFQVLRYGFRPSK
2e89D           EVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNY---EVSIPRNRIRHRVIPELKRINENLEDTFLKMVEE
3b9xC           PSAEFNI--FADPEAARVVFTSGVPLVMMGLDLVCTPDVIARMERAGGPAGELFSDPVHDATCIGY--LI
3dlaA           HYNVNAG--VPKTLIQHLIRWVISAGEFGEKVG-EVLQSVLDTEITAKVGDFSLFQVLRYGFRPSNDAER
2c5sA           VIRPLIT--MDKLEIIKIAEEIGTYDISIRPYREKANRF-EAKYDFTPLIDEAVAMVLQTV---------
3b9xD           NFTPSAEFNIFADEAARVVFTSGVPLVMMGLDLTVCTPDVIARMERAGGAGELFSDIMNFTLKTQFENGL
1b97A           LNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQL
1ee1B           LGAPERLYLISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWW----------------
2detA           SLFPVGE--LEKPQVRKIAEDLGLVT---AKKKDSTGICFIGERKFREFLGRYL----------PAQPGK
3dpiA           DVLPLAG--LTKRRVRALARMLGADEPLVLKTPTGITYEQIDDFLEGKPMDDAVAETVLRFYDATRHKRA
3bl5E           IHTPLMW--LNKAETWKLADELGAL-DFVKNNTLTCYNGIIADG--------------------------
3bl5A           IHTPLMW--LNKAETWKLADELGAL-DFVKNNTLTCYNGIIADG--------------------------
3a4iA           -----PLRDLYKDEVRELAKFLGLPEKIYNRMPF--PGPGLAVRVIGEVTPEKIRIVREANAIVEEEVRA
2dplA           NRMPFPGPGLAVRVIGEVTPEKIRIVREAEEEVERAGLRPWQAFAVLLGVKTVGVQGDIRAYKETGMTAN
2d13C           VFVAVSAYGLNESWLGRELNYKNLE-ELKKLS----EKYGIHIAGEGGEFETFVLDMPFFKAKIVIDDAE
3dpiB           DVLPLAG--LTKRRVRALARMLGADEPAYGITYEQIDDFLEGKPMDDAVAETVLR---------------
2ahjB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
3b9xA           EITPSAEFNIFADEAARVVFTSGVPL--------------------------------------------
2d13B           ----------------------------------------------------------------------
2derB           SLFPVGE--LEKPQVRKIAEDLGLVTTGICFIG-------------------------------------
2d13D           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
2d13A           -------------QYMLEIIKLGFKVVFVAVSAYGLNESWLGRELNYKNLEEL-----------------
1bd9A           CDEPILSDHRGKFKVASFRKKYELRAPVA-----------------------------------------
2e18A           DYAPIIN--LYKTEVWEIAKRIGVPERIVKKKPS------------------------------------
1a44A           CDEPILRSGDHRGKFKSFRKKYELGAPVA-----------------------------------------


                         .         .         .         +         .         .         .:280
query           PREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLI
2deuA           HQGLMYHTLGQRKGLG------------IGGTKEGTEEPWYVVDKDVENNILV-VAQGHEHPRLMSVGLI
2derA           TEEPWYVVDKDVENNILVVAQGHEHPRLMSVGL-IAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKA
2dppB           -------------------------------GIHDVGGMDGFGKVMYVKEE-EDIYFTHDWERLAFGLVA
3dlaB           PSKAFLAWHAWNDAERPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKGGALSPRGDWRAPSDMSAR
2e21A           EAQKLYKEVKKGNCLDVK-KLKEKPLALQRRVIRKFIGEKDYEKVELVRSL---LEKGGEVNLGKGKVLK
2e21B           EAQKLYKEVKKGNCLDVK-KLKEKPLALQRRVIRKFIGEKDYEKVELVRSL---LEKGGEVNLGKGKVLK
2dplB           QGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEV-GRVLYDITNK-----------
3dlaC           PGFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPK----VSHGGALS-PRGDWRAPSDMSAR
3dlaD           AFLAWHAWNDAERGNWPPGFPKSERP-SYSLAEIRHWLQIFVQRFYSFSQF----KRSALPNGPKVSHGG
2e89D           EAQKLYKEVKKGNCLDVK-KLKEKPLALQRRVIRKFIGEKDYEKVELVRSL---LEKGGEVNLGKGKVLK
3b9xC           NPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDLVEECV------------------
3dlaA           GNWPPGFPKSERPSYSLAEIRHWLQRFYSFSQFKRS----ALPNGPKVSHGGAL-SPRGDWRAPSDMSAR
2c5sA           ----------------------------------------------------------------------
3b9xD           AGGPVHDATCIGYLI-----NPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPA-------------
1b97A           RNDYNNISEYRNW---------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
2detA           IITVDGDEIGEHQGLMYHTLGQR-KGLGIGGTKEGTEEPWYVVDKDVENNILV-VAQGHEHPRLMSVGLI
3dpiA           L---------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
3a4iA           GLRPWQAFAVLLGVKTVGVQGDAVRIVESIDGMTANAMNVPWEVLQRIAFREIPEVGRVLYD--------
2dplA           MNVPWEVLQRIAFRITSEIPEVGRVLYDITNKP-------------------------------------
2d13C           KFDGLSGKFII-----------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2ahjB           -----------------------------MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMF
1ahjB           -----------------------------MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMF
3b9xA           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------
2ahjD           -----------------------------MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMF
2d13A           ----------------------------------------------------------------------
1bd9A           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
1a44A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TAHQELENVTVERELARFKRWVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVT
2deuA           AQQLHTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVI---------FDEPVAAVTPGQSAVFYNGEVCLG
2derA           LDDDRI-----EVIFDEPVAAVTPGQSAVFYNGEV-----------------------------------
2dppB           GCMQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIP
3dlaB           IWLDQID---------------------------------------------------------------
2e21A           RKERWL---CFSPEV-------------------------------------------------------
2e21B           RKERWL----------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
3dlaC           IWLDQID---------------------------------------------------------------
3dlaD           ALSPRGDWRAPSD--MSARIW-LDQIDREVPKG-------------------------------------
2e89D           RKERWL----------------------------------------------------------------
3b9xC           ----------------------------------------------------------------------
3dlaA           IWLDQID---------------------------------------------------------------
2c5sA           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
2detA           A---------------------------------------------------------------------
3dpiA           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2dplA           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2ahjB           AGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEV
1ahjB           AGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKG-----------------------
3b9xA           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------
2ahjD           AGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVQDELESLAGGPFPLSRPSESEGRPAPVETTTFEV
2d13A           ----------------------------------------------------------------------
1bd9A           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
1a44A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIANMRDxxxx
2deuA           GGIIEQRLP----------------------------------------
2derA           -------------------------------------------------
2dppB           RREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPT----
3dlaB           -------------------------------------------------
2e21A           -------------------------------------------------
2e21B           -------------------------------------------------
2dplB           -------------------------------------------------
3dlaC           -------------------------------------------------
3dlaD           -------------------------------------------------
2e89D           -------------------------------------------------
3b9xC           -------------------------------------------------
3dlaA           -------------------------------------------------
2c5sA           -------------------------------------------------
3b9xD           -------------------------------------------------
1b97A           -------------------------------------------------
1ee1B           -------------------------------------------------
2detA           -------------------------------------------------
3dpiA           -------------------------------------------------
3bl5E           -------------------------------------------------
3bl5A           -------------------------------------------------
3a4iA           -------------------------------------------------
2dplA           -------------------------------------------------
2d13C           -------------------------------------------------
3dpiB           -------------------------------------------------
2ahjB           GQRVRVRDEYVPGHIRMPAYCRGR-------------------------
1ahjB           -------------------------------------------------
3b9xA           -------------------------------------------------
2d13B           -------------------------------------------------
2derB           -------------------------------------------------
2d13D           -------------------------------------------------
2ahjD           GQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKW-------------
2d13A           -------------------------------------------------
1bd9A           -------------------------------------------------
2e18A           -------------------------------------------------
1a44A           -------------------------------------------------