[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56191.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cw9A.bssp"
#ERROR : Can't open dsspfile "2d1sA.bssp"
#ERROR : Can't open dsspfile "2d1qA.bssp"
#ERROR : Can't open dsspfile "2d1tA.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "3dlpX.bssp"
#ERROR : Can't open dsspfile "1amuB.bssp"
#ERROR : Can't open dsspfile "3cw8X.bssp"
#ERROR : Can't open dsspfile "3e7wA.bssp"
#ERROR : Can't open dsspfile "2d1rA.bssp"
#ERROR : Can't open dsspfile "3dhvA.bssp"
#ERROR : Can't open dsspfile "3c5eA.bssp"
#ERROR : Can't open dsspfile "3b7wA.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "3dayA.bssp"
#ERROR : Can't open dsspfile "3e53A.bssp"
#ERROR : Can't open dsspfile "2efjA.bssp"
#ERROR : Can't open dsspfile "3cbpA.bssp"
#ERROR : Can't open dsspfile "3cbmA.bssp"
#ERROR : Can't open dsspfile "3cboA.bssp"
#ERROR : Can't open dsspfile "3c30A.bssp"
#ERROR : Can't open dsspfile "2d42A.bssp"
#ERROR : Can't open dsspfile "2atwC.bssp"
#ERROR : Can't open dsspfile "2atwA.bssp"
#ERROR : Can't open dsspfile "2e22A.bssp"
#ERROR : Can't open dsspfile "2e0cA.bssp"
#ERROR : Can't open dsspfile "2c4iA.bssp"
#ERROR : Can't open dsspfile "3dmyA.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "3bbjA.bssp"
#ERROR : Can't open dsspfile "3bl4A.bssp"
#ERROR : Can't open dsspfile "2e1dB.bssp"
#ERROR : Can't open dsspfile "3e3cA.bssp"
#ERROR : Can't open dsspfile "3bbjB.bssp"
#ERROR : Can't open dsspfile "1dl3A.bssp"
#ERROR : Can't open dsspfile "2ehpA.bssp"
#ERROR : Can't open dsspfile "2cwwA.bssp"
#ERROR : Can't open dsspfile "2cwnA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2c24A.bssp"
#ERROR : Can't open dsspfile "3cq0A.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "2e12A.bssp"
#ERROR : Can't open dsspfile "2cb6G.bssp"
#ERROR : Can't open dsspfile "2c24B.bssp"
#ERROR : Can't open dsspfile "3dmyB.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"
#ERROR : Can't open dsspfile "2djvA.bssp"
#ERROR : Can't open dsspfile "3cqcB.bssp"
#ERROR : Can't open dsspfile "3dwmA.bssp"
#ERROR : Can't open dsspfile "1aq2A.bssp"
#ERROR : Can't open dsspfile "3b77A.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "2cwnB.bssp"

## Summary of PDB Search
:515
    2e-87  27%  3cw9A  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    4e-84  26%  2d1sA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    2e-81  27%  2d1qA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    3e-81  27%  2d1tA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    8e-81  26%  1ba3A  [x.x.x] LUCIFERASE
    8e-81  25%  3dlpX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    2e-80  23%  1amuB  [e.23.1] GRAMICIDIN SYNTHETASE 1
    3e-79  26%  3cw8X  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    1e-77  20%  3e7wA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    5e-77  27%  2d1rA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    6e-75  20%  3dhvA  [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
    3e-73  26%  3c5eA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    2e-67  25%  3b7wA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    1e-66  23%  1amuA  [e.23.1] GRAMICIDIN SYNTHETASE 1
    3e-65  24%  3dayA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A,
    1e-54  19%  3e53A  [x.x.x] FATTY-ACID-COA LIGASE FADD28
    9e-48   8%  2efjA  [x.x.x] 3,7-DIMETHYLXANTHINE METHYLTRANSFERASE
    3e-39  13%  3cbpA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    4e-36  13%  3cbmA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    3e-35  10%  3cboA  [x.x.x] HISTONE-LYSINE N-METHYLTRANSFERASE SETD7
    5e-34   7%  3c30A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    7e-34   8%  2d42A  [x.x.x] NON-TOXIC CRYSTAL PROTEIN
    6e-33   8%  2atwC  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    2e-32   8%  2atwA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    1e-30  10%  2e22A  [x.x.x] XANTHAN LYASE
    2e-30  12%  2e0cA  [x.x.x] 409AA LONG HYPOTHETICAL NADP-DEPENDENT
    3e-30  10%  2c4iA  [x.x.x] AVIDIN
    2e-28  11%  3dmyA  [x.x.x] PROTEIN FDRA
    6e-22   9%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    7e-21  19%  3bbjA  [x.x.x] PUTATIVE THIOESTERASE II
    8e-21  11%  3bl4A  [x.x.x] UNCHARACTERIZED PROTEIN
    8e-21   6%  2e1dB  [x.x.x] TRANSALDOLASE
    7e-20  14%  3e3cA  [x.x.x] L0044
    8e-20  11%  3bbjB  [x.x.x] PUTATIVE THIOESTERASE II
    1e-18   7%  1dl3A  [c.1.2] PROTEIN (PHOSPHORIBOSYLANTRANILATE ISOMERASE)
    2e-18   7%  2ehpA  [x.x.x] AQ_1627 PROTEIN
    5e-18   8%  2cwwA  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    2e-17   6%  2cwnA  [x.x.x] TRANSALDOLASE
    7e-17   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    5e-16  15%  2c24A  [x.x.x] ENDOGLUCANASE
    2e-15   7%  3cq0A  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    2e-15   8%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    9e-15   9%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    2e-14  18%  2e12A  [x.x.x] HYPOTHETICAL PROTEIN XCC3642
    7e-13  10%  2cb6G  [x.x.x] MOSQUITOCIDAL TOXIN
    7e-13  14%  2c24B  [x.x.x] ENDOGLUCANASE
    2e-12  12%  3dmyB  [x.x.x] PROTEIN FDRA
    5e-11   6%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    2e-09  11%  2djvA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    2e-09  11%  3cqcB  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP133
    3e-08  14%  3dwmA  [x.x.x] 9.5 KDA CULTURE FILTRATE ANTIGEN CFP10A
    1e-07  13%  1aq2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE
    3e-05   8%  3b77A  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-04  15%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-04   7%  2cwnB  [x.x.x] TRANSALDOLASE
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
3cw9A           ------MLRRAATRAPDHCALAVPARGLRLTHAELRARAVAARLHADGLRPQQRVAVVAPNSADVVIAIL
2d1sA           -GSAGTQLRKYMERYAKLGAIAFTGVDYSYAEYLEKSCLGKALQN-YGLVVDGRIALCSENCEEFFIPVI
2d1qA           -GSAGTQLRKYMERYAKLGAIAFTNAGVDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCEEFFIPVI
2d1tA           -GSAGTQLRKYMERYAKLGAIAFTNADYSYAEYLEKSCLGKAL-QNYGLVVDGRIALCSENCEEFFIPVI
1ba3A           -GTAGEQLHKAMKLVPGTIAFTDAHINITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVL
3dlpX           ------MLRRAATRAPDHCALAVPARGLRLTHAELRARAVAARLHADGLRPQQRVAVVAPNSADVVIAIL
1amuB           -KTIHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
3cw8X           ------MLRRAATRAPDHCALAVPARGLRLTHAELRARAVAARLHADGLRPQQRVAVVAPNSADVVIAIL
3e7wA           -MKLLHAIQTHAETYPQTDAFRSQGQSLTYQELWEQSDRAAAAIQKRSGEKKSPILVYGHMEPHMIVSFL
2d1rA           -GSAGTQLRKYMERYAKLGAIAFAVTGVDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCEEFFIPVI
3dhvA           ------QIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
3c5eA           -VLDHWADMEKAGKRPPSPALWWVNGMWNFRELSENSQQAANVLSACGLQRGDRVAVVLPRVPEWWLVIL
3b7wA           -VLDHWADMEKAGKRPPSPALWWVNGMWNFRELSENSQQAANLSGACGLQRGDRVAVVLPRVPEWWLVIL
1amuA           --TIHQLFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
3dayA           -VLDHWADMEKAGKRPPSPALWWVNGMWNFRELSENSQQAANVLSACGLQRGDRVAVVLPRVPEWWLVIL
3e53A           --SLPAALRACARLQPHDPAFTFDYETLTWSQLYRRTLNVAQELSRCGS-TGDRVVISAPQGLEYVVAFL
2efjA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cboA           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2e0cA           ----------------------------------------------------------------------
2c4iA           ----------------------------------------------------------------------
3dmyA           --------LSRVTARRNAIAPVSSGFICGLYTGGTLAAEAAGLLA--GHLGVETHQHGLDADSHQIIDLG
1b8aA           ----------------------------------------------------------------------
3bbjA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           --FVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGK-DRILIKLSSTWEGIQAGK
3e3cA           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1dl3A           -ITNLEDALFSVESGADYVGFVFYPKSKRYI-------SPEDARRISVELPVERVGVFVNEEPEKILDVA
2ehpA           ------THEGKVEGVPGNYPLTAGLALCTLWILDKEIEEPTLSIPALSVGFNAGGSVNVGKGGDIKLFLQ
2cwwA           ----------------------------------------------------------------------
2cwnA           -----FGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGK-DRILIKLSSTWEGIQAGK
1e3aB           ----------------------------------------------------------------------
2c24A           ----------------------------------------------------------------------
3cq0A           -----------LKVVPGRVSTEVDARSFDKKATVKKALHIIKLYKDAGVP-KERVLIKIASTWEGIQAAR
2ao0A           -------------------------------------QKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHI
2cwwB           ----------------------------------------------------------------------
2e12A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3dmyB           -------------------------------------------------------QHGLDADSHQIIDLG
2asbA           ----------------------------------------------------------------------
2djvA           ------------------GSSGTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEV------AAEVAKL
3cqcB           DFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKIL--------------LPEVKDLLQADE
3dwmA           -DTLGAVISDLEANYSGISERLMGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPA----------
1aq2A           -------VKPVSKAGHATKVIFLTFGVLPPVSRLTADQTQYHFLSGFTAKLAGTITEPTPTF--------
3b77A           ----------------------------------------------------------------------
1d4gA           ---------------PYKVADIGGRKALDIANEMPGLMRMREMYSASKPLKGARIAGCLHMTVE-TAVLI
2cwnB           KLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGK-DRILIKLSSTWEGIQAGK


                         .         .         *         .         .         .         .:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
3cw9A           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLGDLV---------
2d1sA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKKGDKVITVQKTVTTIKTIVILDSKVDYRGYQCL
2d1qA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKK-----GLDKVITVQKTVTTIKTIVILDSKVDY
2d1tA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFS---SKKGLDKVITVQKTVTTIKTIVILDSKVDYRG
1ba3A           GALFIGVAVAPANDIYNERELLNSMNISQPTVVFVSKKGQKILNVQKKLPIIQKI------IIMDSKTDY
3dlpX           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVGRQVADAIFQSGSGARIIFLGDLV---------
1amuB           AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLIHNQFNGQVEIF----------------
3cw8X           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVI-------------AVGRQVADAIFQSGSGA-----
3e7wA           GSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAA--------GLSIDAVGQQIQTVSA---------
2d1rA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFS---SKKGLDKVITVQKTVTTIKTIVILDSKVDYRG
3dhvA           GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTH---------
3c5eA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAG---------DEVIQEVDTVASECPSLRIKLLV--
3b7wA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGD-----EVIQEVDTVASECPSLRIKLLVS-----
1amuA           AVLKAGGAYVPIDIEYPKERIQYILDDSQAR----------------MLLTQKHLVHLIHNIQFNG----
3dayA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKS-------
3e53A           GALQAGRIAVPLSVPQRSDSVLSDSSPVAILTTSSAVDDVV-----------------------------
2efjA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cboA           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2e22A           ---------------------------------------------------------------------E
2e0cA           ----------------------------------------------------------------------
2c4iA           ----------------------------------------------------------------------
3dmyA           DDFYTVGRPHPIDPTLRNQLIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARLDN-----
1b8aA           ----------------------------------------------------------------------
3bbjA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           ELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGR-----ILDWHVANTKKSYEPQGDPGVKSVTIY
3e3cA           ----------------------------------------------------------------------
3bbjB           ----------------------------------------------------------------------
1dl3A           SYVQLNAVQLHGEEPIELCRKIAERILVWKAVGV---------------------SNERDMERALNYREF
2ehpA           KGEIYVLEFQPLSETD-IKKLESILFGRAPIPKKT-----------------------------------
2cwwA           ----------------------------------------------------------------------
2cwnA           ELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANKKSYEPQGDPGVKSVTKIYNYYKK
1e3aB           ------------------------------------------------------------------VIGK
2c24A           ----------------------------------------------------------------------
3cq0A           ELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMDFYKALDYTAETDPGVLSVKKIYSYYKRHG
2ao0A           DCAAIYGNELEIGEALQETVGP---GKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYL
2cwwB           ----------------------------------------------------------------------
2e12A           ---------------------------------------------------------------MPKYAPH
2cb6G           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3dmyB           DDFYTVGRPHPIDPTLRNQLIADLGAKPQVRVLL--------LDVVIGFGATADPAASLVSAWQKACAAR
2asbA           ----------------------------------------------------------------------
2djvA           LDLKKQLAV-------------------------------------------------------------
3cqcB           FVLKANYEYYVQGQI-------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           -SACFGAAFLSLHPTQYAEVLVKRMQAAGAQAYLVNTG--------------------------------
3b77A           ----------------------------------------------------------------------
1d4gA           ETLVALGAEVR-----WSSCNIFSTQNHAAAAI-AKAGIPVFWKGETDEEYLWCIEQTLHFKDGPLNMIL
2cwnB           ELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANQGDPGVKSVTKIYNYYKKF-----


                         +         .         .         .         .         *         .:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
3cw9A           ----------RDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
2d1sA           ----DTFIKRNTPPGFQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQ
2d1qA           R--GYQCLDTFIKRNTPPGFQASSFKTVEVDRKEQVALIMNSSLPKGVQLTHENIVTRFSHARDPIYGNQ
2d1tA           YQCLDTFIKRNTPPGYQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQ
1ba3A           QGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSTGLPKGVALPHRTACVRFSHARDPIFGNQ
3dlpX           ----------RDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
1amuB           ----------EEDTIKIREGTNLHVPSKSTDLAYVIYT-----NPKGTMLEHKGISNLKVFFENSLNVTE
3cw8X           -RIIFLGDLVRDGEPYSYGPPIEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
3e7wA           ----------EELLENEGGSVSQDQWVKEHETFYIIYTSGSTGNPKGVQISAANLQSFTDWICADFPVSG
2d1rA           YQCLDTFIKRNTPPGFQASSFKTVEVDRKEQVALIMNSSGSTGLPKGVQLTHENIVTRFSHARDPIYGNQ
3dhvA           ---------------------KGNTPNPEHAVKGDENFYIIYTSPKGVQITYNCLVSFTKWAVEDFNLQT
3c5eA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQA
3b7wA           -EKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQA
1amuA           -----QVEIFEEDTIKIREGTNLHVPSKSTDLAYVIYTS-----PKGTMLEHKGISNLKVFFENSLNVTE
3dayA           ----CDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQA
3e53A           ---------QHVPPSIIEVDLLDLDAPEYPSTAYLQYTPAGVVSHQNVRVNFEQLSGYFAD------GIP
2efjA           ----------------------------------------------------------------------
3cbpA           ----------------------------------------------------------------------
3cbmA           ----------------------------------------------------------------------
3cboA           ----------------------------------------------------------------------
3c30A           ----------------------------------------------------------------------
2d42A           ---------------------------------------------------------NLLRELEIYGMQY
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2e22A           DMDLSSSRTYIWYAL---RGNGTSDNVNAVYERLRTMALAATTVGSSLYGNADLKEDILDALDWLYVNSY
2e0cA           ----------------------------------------------------------------------
2c4iA           -------------------------------------------------------------------QPT
3dmyA           -----------------------------QPLYAIATVTGTERDPQCRSQQIATLEDAGIAVVSSLPEAT
1b8aA           ----------------------------------------------------------------------
3bbjA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           NYYKKFGYKTIVMGASFRNTGEIKFLTISPKLLGELLKDNSKLAPALSVKAAQTSDSEKIHLDEKAFRWL
3e3cA           ------------------------SMIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQG--V
3bbjB           ----------------------------------------------------------------------
1dl3A           PILLDTDWSLILPYRDRFRYLVLSGGLNPENVRSAIDVVR----PFAVDVSSGVEAFPGKKDHDSIKM--
2ehpA           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
2cwnA           FYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQTSDSEKIHLDEKAFRWL
1e3aB           SKAQDAKAIMVNGPQFGWYAPAYTYGIGLHGAGYDVTGNTPFAYPGLV-FGHNGVISWGST----AGFGD
2c24A           ----------------------------------------------------------------------
3cq0A           YATEVMAASFRNLDEL-KALAGIDNMTLPLNLLEQLYESTDPIENKLNSESAKEEGVEFINDEPHFRYVL
2ao0A           MHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFDVLSVASVRPAVLQVEC
2cwwB           ----------------------------------------------------------------------
2e12A           VYTEQAQIAT-LEHWVKLLDGQERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHLDASQ
2cb6G           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3dmyB           LD--------------------------NQPLYAIATVTGTERDPQCRSQQIATLEDAGIA------VVS
2asbA           ----------------------------------------------------------------------
2djvA           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
1d4gA           DDGGDLTNLIHTKH--------------------------------------------------------
2cwnB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
3cw9A           GRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAAA
2d1sA           SPGTAVLTVVPFHHGFGM-FTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSEL
2d1qA           SPGTAVLTVVPFHHGFGMFTTL-GYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSEL
2d1tA           SPGTAVLTVVPFHHGFGM-FTTLGYLICGFRVVMLTKFDEETFLKTLQDYKCTNVILVPTLFAILNKSEL
1ba3A           IIPDAILSVVPFHHGFGMFTTL-GYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL
3dlpX           GRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAAA
1amuB           K--DRIGQFASISFDASVWEMFMALLTGASLYIKDTINDFVKFEQYINQKEITVITLPPTYVVHLDPERI
3cw8X           GRHNVVLGLMPLYHVVGFFAVLVAALALDGTYVVIEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAAA
3e7wA           G--KIFLNQAPFSFDLSVMDLYPCLQSGGTLHCVTKVNKPKVLFEELKKSGLNVWTSTPSFVQMCLMDPG
2d1rA           VSGTAVLTVVPFHHGFGMFTTL-GYLICGFRVVMLTKFDEETFLKTLQDYKCTSVILVPTLFAILNKSEL
3dhvA           G--QVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEAS
3c5eA           S--DIMWTISDTGXXXXXXXXXXXXXXXXXXXXXLPKFD---PLVILKXXXXXXXXXXXXXXXXXXXXXX
3b7wA           S--DIMWTISDTGXXXXXXXXXXXXXXXXXXXXXLPKFD---PLVILKXXXXXXXXXXXXXXXXXXXXXX
1amuA           K--DRIGQFAS-ISFDASVWEMFMALLTGASLYIILKDTINDFVKFEQQKEITVITLPPTYVVHLDPERI
3dayA           S--DIMWTISDTGXXXXXXXXXXXXXXXXXXXXXLPKFDPLV---ILKXXXXXXXXXXXXXXXXXXXXXX
3e53A           PPNSALVSWLPFYHDGLVIGICAPILGGYPAVLTSPVSFLQRPARWHLASDFHAFSAAPNFAFELARRTT
2efjA           SSYNLFLIRVKPVLEQCIQELL-RANLPNINKCFKVGDL-------GCASGPNTFSTVRDIVQSIDKVPT
3cbpA           ----------------------------------------------------WIYYPDGGSLVGEVNEDG
3cbmA           ----------------------------------------------------WIYYPDGGSLVGEVNEDG
3cboA           ---------------------------------------------------WIYYPDGGSLVGEVNEDGE
3c30A           ----------------------------------------------------------------------
2d42A           ANSHQYT-----YGSSYSDDTNPIRIAGLDARIPDPIVTDPVNHIVLDRRIITNTTSNSLEGVFSFSNAY
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2e22A           N--STRSRSAYNWWHWQLGIPMSLNDIAVLLYDDISAARMATYMDTIDYFTPSIGLTGANRAWQAIVVGV
2e0cA           ----------------------------------------------------------------------
2c4iA           FGFTVNWKFSESTTVFTGQC----FIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLKCSLTG
3dmyA           L--LAAALIHPLSHTPSLLENV-AVINIGLRSFALELQ--SASKPVVHYQWSPVAGGNKKLA--------
1b8aA           ----------------------------------------------------------------------
3bbjA           ----------------------------------------------------------------------
3bl4A           ----------------------------------------------------------------------
2e1dB           HNEDQMAVEK------------------------------------------------------------
3e3cA           LSEDEDIILHVHRYNYEIPSVL--NIEQDYQLVIPKKVDNNLTLHCHVRGNEKLFVDVYAKFIEPL----
3bbjB           ----------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
2cwnA           HNEDQMAVEK------------------------------------------------------------
1e3aB           DVDIFAERLSAEKPGYYLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNILQTDQTTQTAYAKS-RA
2c24A           ----------------------------------------------------------------------
3cq0A           NEDQMATEKLS-----------------------------------------------------------
2ao0A           HPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDVLLEEPVVQALAEKYNRSPAQILLRWQVQ-RKVIC
2cwwB           ----------------------------------------------------------------------
2e12A           EPMDRIVAVHPM----------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
2c24B           ----------------------------------------------------------------------
3dmyB           SLPEATLLAAALIHPLHTPSLLE---NVAVINIGLRSFALE-----------------------------
2asbA           ----------------------------------------------------------------------
2djvA           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3b77A           ----------------------------------------------------------------------
1d4gA           ----------------------------------------------------------------------
2cwnB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
3cw9A           HAGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT-GTEMAPGFFSEV
2d1sA           LNKYDLSN--LVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASGKVVPL
2d1qA           LNKYDLSN--LVEIASGGAPLSKEVGEAVARRFNPGVRQGYGLTETTSAIIITPEGD-DKPGASGKVVPL
2d1tA           LN--KYDLSNLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASGKVVPL
1ba3A           IDKYDL--SNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPF
3dlpX           HAGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQP-KTGTEMAPGFFSEV
1amuB           LS--------IQTLITAGSATSPSLVNKWKEKVTYINAYGPTETTICATTWVATKETIGHSVPIGAPIQN
3cw8X           HAGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT-GTEMAPGFFSEV
3e7wA           FSQDLLPHADTF--MFCGEVLPVSVAKALLERFPAKIFNTYGPTEATVAVTSVEITNDVESLPVGFAKPD
2d1rA           LNKYDLSNLVEI--ASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASGKVVPL
3dhvA           FSESMLPNMKTF--LFCGEVLPNEVARKLIERFPATIMNTYGPTEATVAVTGIHVTEEYKSLPVGYCKSD
3c5eA           XDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCM-VSKTMKIKPGYMGTAASC
3b7wA           XDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLT-CMVSKTMKIKPGYMGTAASC
1amuA           LS--------IQTLITAGSATSPSLVNKWKEKVT--YINAYGPTETTICATTWVAETIGHSVPIGAPIQN
3dayA           XDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMK-IKPGYMGTAASC
3e53A           DDDAGRDLGNILTILSGSERVQAATIKRFADRFERVIRPSYGLAEATVYVATSAKPCAGATSLISYLPRS
2efjA           IQI------FLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLPEESMHFLHSCYC
3cbpA           EMT-----GEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYCISTNALLPDP
3cbmA           EEKIAYVYPDERTALYGKFIDG--------EMIEGKLATLMSTEEGRPHFELMPGNSVYCISTNALLPDP
3cboA           MTGEAYVYPDERTALYGKFIDGEM--------IEGKLATLMSTEEGRPHFELMPGNSSSCISTNALLPDP
3c30A           ---------------------------------------------------------------------S
2d42A           TSRTSSQTRDGVTAGTNITGKYFANLFFEQVGLSGRIAFEGAVTNENKYTLDATQDFR-DSQTIRVPPFH
2atwC           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2e22A           RAVIVKDAVKLAAARLSGTGIFPYATGGDGFYADGSFVQHTTFAYTGGYGSSVLETANLMYLLSGSTW-S
2e0cA           ----------------------------------------KEPEDGEKIKFDKKPVILYIEGDIGPEITN
2c4iA           KWTNDLGSMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTIGSTTVFTGQCFIDRNGKEVLKTM
3dmyA           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
3bbjA           ----------LARVDVDFSPDSYAALARERT-VTTPELCGYVDLSARDGGSAKDPLAF-LPLAVDALPPI
3bl4A           ------------------------------------------------------------GTEAGLTLGD
2e1dB           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
3bbjB           ----------LARVDVDFSPDSYAALARERT-VTTPELCGYVDLSARDGGSAKDPLAF-LPLAVDALPPI
1dl3A           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2cwwA           -----------------------------------------------------------VNAKGAARLLS
2cwnA           ----------------------------------------------------------------------
1e3aB           WDGKEVASLLAWTHQMKAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHT---------GAYPDRQSHD
2c24A           ----------------------------------------------------------------------
3cq0A           ----------------------------------------------------------------------
2ao0A           IPKSVTPSRILQNIQVFDFTFSPEEMKQLDANLRFIVPMLTVDGKRVPRD-AGHPL---YPFND------
2cwwB           ------------------------------------------------------------NAKGAARLLS
2e12A           ----------------------------------------------------------------------
2cb6G           -SLLYQLISTRIPSFASPNGLHMREQTIDSNTGQIQIDEHRLLWDRPPNDIFLNGFIPRVTNQNLSPVED
2c24B           ----------------------------------------------------------------------
3dmyB           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
2djvA           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3b77A           ---------------------------------------------------------------------G
1d4gA           ----------------------------------------------------------------------
2cwnB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
3cw9A           RIVRIGGGVEIVANGEEGELIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
2d1sA           FKAKIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKEIDEEGWLHTGDIGYYDEEKHFFIVDRLKS
2d1qA           FKAKVIDLDTKKSLGPNRRGVCVKGPMLMKGYVNNPEATKELIDEEGWLTGDIGYYDEEKHFFIVDRLKS
2d1tA           FKAKVIDLDTKKSLGPNRGEVCVKGPMLMKGYVNNPEATKELDEEGWLHTGDIGYYDEEKHFFIVDRLKS
1ba3A           FEAKVVDLDTGKTLGVNQRELCVRGPMIMSGYVNNPEATNALDKDGWLHSGDIAYWDEDEHFFIVDRLKS
3dlpX           RIVRIGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATAELQDGWYRTSDVAVWTPEGTVRILGRVPD
1amuB           TQIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVEKLYKTGDQARWLSDGNIEYLGRIDN
3cw8X           RIVRIGGGVDEIVANGEEGELIVAASDSAFGYLNQPEATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
3e7wA           MNIFIMDEEGQPLPEGEKGEIVIAGPSVSRGYLGEPELTEKAHEGQWAYRTGDAGFIQDGQIFCQGRLDF
2d1rA           FKAKVIDLDTKKSLGPNRRGEVVKGPMLMKGYVNNPEATKELDEEGWLHTGDIGYYDEEKHFFIVDRLKS
3dhvA           CRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAIDGERAYKTGDAGYVENGLLFYNGRLDF
3c5eA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDKRGDFWLLGDRGIKDEDGYFQFMGRADD
3b7wA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGYVDNPDIRGDFWLLGDRGIKDEDGYFQFMGRADD
1amuA           TQIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVEKLYKTGDQARWLSDGNIEYLGRIDN
3dayA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIRPIGIFSGDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
3e53A           PIVRIVDSDTCIECPDGTVEIWVHGDNVANGYWQKPDESERTFEGPWLRTGDSGFVTDGKFI--------
2efjA           LHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSLLTFICKEDEFDHPNSMDEKLD
3cbpA           YESERVYVSLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRTLSLDEETVIDVPEPYNHVSYCAS
3cbmA           YESERVYVAESLISSAGEGLFSAVGPNTVMSFYNGVRITHQEVDNTLSLDEETVIDVPEPYNHVSKYCAS
3cboA           YESERVYVAESLISSAGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWLDEETVIDVPEPYNHVSKYCAS
3c30A           LIQSLFDFRLAALRIHQDSTA--KNASLINALVSRDSSRLDEFFSSRFISSHDNILWDDGNASFYGIAQQ
2d42A           RATGVYTLEQGAFEKMTVLECVVSGNGIIRYYRTLPDNSYTEIVFTISKEQNRAYFTGEGTISGQIGLQT
2atwC           ---EFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAECYVVGVTRGAREPLITLSRTHP
2atwA           ------TREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQYVVGVTRGAREPLITLSRTHP
2e22A           VSDPNQSNVWQWIYEAGAMMDMVRGREISRSYAQDHAVGHGIVAS-------------------------
2e0cA           AAIKVINKAVERAYGSSRLEVYAGEKAEKLVNDRFPKETQ--EMLLKYRVVLKGPLE-SVNVAIRLMLDL
2c4iA           WLLRSSVDIGDDWKATRVGINIFTRKCSLTGKWTNDLGSNMTIGAVNSRG-----EFTGTYITAVTATSN
3dmyA           ----------------------------------------------------------------------
1b8aA           -----------------------------------------------YRTHY----SSEITEELNGQKVK
3bbjA           VSLLVDWSWAPTVELTWPGPLAFRSTCAL-------------VSDGWFDE-NVDLWDARGRLVAQSRQLA
3bl4A           GILRLTWPRGAAIRALRVNQLCGDDRHPLVDATTADVSR--GARAVFGRPCQASRIALLGSSPVDRVLAN
2e1dB           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
3bbjB           VSLLVDWSWAPTVEL----------TWHLRAIPEPGPLAFCALVSDGWFDENVDLWDARGRLVAQSRQLA
1dl3A           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2cwwA           RHLWVFRRDVVSGETPGLYPVYWGRRFLALALYNPHTDLAVRAYRFAPAEDPVA----------------
2cwnA           ----------------------------------------------------------------------
1e3aB           PRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSPQVTEIDRLLEQKPRLTADQAWDVIRQTSRQ
2c24A           --------------GSGMGELETIGVDTTVTYNGLPTLRLNVQTTVGWNTHDLSQYVENGYLEFDIKEDF
3cq0A           ----------------------------------------------------------------------
2ao0A           ----------------------------------------------------------------------
2cwwB           RHLWVFRRDVVSGETPGLYPVYWGRRFLALALYNPHTDLAVRAYRFAPAEDPVAALLENLAQALARREAV
2e12A           ----------------------------------------------------------------------
2cb6G           THLLNYLRTNSPSIFVSTTRARYNNLGLEITPWTPNNNIIYRYEIFAPGGIDINASFNQDEITFPGGIRP
2c24B           -----------------MGELETIGDTLPVDYNGLPTLRLNVQTTVGWNTHDLSQYVEFDIKGKEGGEDF
3dmyB           ----------------------------------------------------------------------
2asbA           ------TREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQYVVGVTRGAREPLITLSRTHP
2djvA           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3b77A           ESASKRVLYRYPYAHYPIRHVFETGTVDLDVKFEIGGKHYSIDVDHVKDLYKALLAIAEKQYEGQKLEFA
1d4gA           ----------------------------------------------------------------------
2cwnB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK
3cw9A           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLADALDTFCRSSELADFK
2d1sA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGNMTEKEVMDYVASQVSNAKR
2d1qA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAR
2d1tA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDVASQVSNAKR
1ba3A           LIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAK
3dlpX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPLGETLSADALDTFCRSSELADFK
1amuB           QVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQL--RQFSSEELPTYM
3cw8X           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQWGQSVTACVVPRLGETLSADALDTFCRSSELADFK
3e7wA           QIKLHGYRMELEEIEFHVRQSQYVRSAVVIPYQPNGTVEYLIAAIVPEEHEFQLTSAIKKELAASLPAYM
2d1rA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAK
3dhvA           QIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKTSAIKKELNERLPNYM
3c5eA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDKELQQHVKSVTAPYK
3b7wA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHTKELQQHVKSVTAPYK
1amuA           QVKIRGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVS--EKHIPLEQLRQFSSEELPTYM
3dayA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDRGEVVKAFVVLALSHDPEQLTKELQQHVKSVTAPYK
3e53A           ----------------------------------------------------------------------
2efjA           SFNVPIYAPSTEEVKRIVEEEGSILYLETFNAPYDAGFSISPVSCDEAHVASVVRSIYEPILASHFGEAI
3cbpA           LGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELVAYGYDHEAPEWYQVELKAFQA-------
3cbmA           LGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPEAPEVELKAFQATQ-----
3cboA           LGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYEAP-EWYQVELKAFQATQ-----
3c30A           ELNKLIRRVAISGNWHLVQTPSEGKSVHILRRSSLIEATGQVVGYLYVGIVLNDNFALLENIRSGSNSEN
2d42A           FIDVVIEPLPGH----------------------------------------------------------
2atwC           NLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIG--PMGQRVRNVMSELSGEK
2atwA           NLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIG--PMGQRVRNVMSELSGEK
2e22A           ----------------------------------------------------------------------
2e0cA           YANIRPVKYIE-GLESPLKHPEKVDMIIFRENTDD--LYRGIEYPFNSEEAKKIRDFLRKELKVEIEDDT
2c4iA           EIKESPLHGTQNTINK----RTQPTFGFTVN---------------------------------------
3dmyA           ----------------------------------------------------------------------
1b8aA           VAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEI
3bbjA           RVGR------------------------------------------------------------------
3bl4A           FF--LGINAVPCPTKFFTSERDALTWLAL-----------------------------------------
2e1dB           ----------------------------------------------------------------------
3e3cA           ----------------------------------------------------------------------
3bbjB           RVGR------------------------------------------------------------------
1dl3A           ----------------------------------------------------------------------
2ehpA           ----------------------------------------------------------------------
2cwwA           ----------------------------------------------------------------------
2cwnA           ----------------------------------------------------------------------
1e3aB           DLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTQQPGSAILNVWLTSMLKRTVVAAV
2c24A           VIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQH--VKIPLRDLMKINNGFDPSSVT---CLVFSKRYA
3cq0A           ----------------------------------------------------------------------
2ao0A           ----------------------------------------------------------------------
2cwwB           LRQDPEGGYRLVHAEGDLLPGLV-----------------------------------------------
2e12A           ----------------------------------------------------------------------
2cb6G           EFIRSTYEYHNGEIVRIWINPNFINPSTLNDVSGPSNISKVFWHENHSEGNNMKGFILDLDYNQDFDMFA
2c24B           VIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPLRDLMKINNGFDPSSVTCL-----VFSKRYA
3dmyB           ----------------------------------------------------------------------
2asbA           NLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKID
2djvA           ----------------------------------------------------------------------
3cqcB           ----------------------------------------------------------------------
3dwmA           ----------------------------------------------------------------------
1aq2A           ----------------------------------------------------------------------
3b77A           NSSLNGGLRQGDNVPQTFKDLSQESFDWLQGHYYKWNQKDF-----------------------------
1d4gA           ----------------------------------------------------------------------
2cwnB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           YPRIVEFRTELPMTATGKILKRELR
3cw9A           RPKRYFILDQLPKNALNKVLRRQLV
2d1sA           LRGGVRFVDEVPKGLTGKIDGRAIR
2d1qA           LRGGVRFVDEVPKGLTGKIDGRAIR
2d1tA           LRGGVRFVDEVPKGLTGKIDGRAIR
1ba3A           KRGGVVFVDEVPKGLTGKLDARKIR
3dlpX           RPKRYFILDQLPKNALNKVLRRQLV
1amuB           IPSYFIQLDKMPLTSNGKIDRKQLP
3cw8X           RPKRYFILDQLPKNALNKVLRRQLV
3e7wA           IPRKFIYQDHIQMTANGKIDRKRIG
2d1rA           RRGGVRFVDEVPKGLTGKIDGRAIR
3dhvA           IPRKFMYQSSIPMTPNGKVDRKKLL
3c5eA           YPRKIEFVLNLPKTVTGKIQRAKLR
3b7wA           YPRKIEFVLNLPKTVTGKIQRAKLR
1amuA           IPSYFIQLDKMPLTSNGKIDRKQLP
3dayA           YPRKIEFVLNLPKTVTGKIQRAKLR
3e53A           -------------------------
2efjA           LPDLSHRIAKNAAK---VLRSGKGF
3cbpA           -------------------------
3cbmA           -------------------------
3cboA           -------------------------
3c30A           LVLAVDTT-PLVSTLKGNEPYSLD-
2d42A           -------------------------
2atwC           IDIIDYDDDPARFVANALSPAKVVS
2atwA           IDIIDYDDDPARFVANALSPAKVVS
2e22A           -------------------------
2e0cA           GIGIKVMSKYKTQRITRLAIQYAIE
2c4iA           -------------------------
3dmyA           -------------------------
1b8aA           LPEKIVVLNRAET------------
3bbjA           -------------------------
3bl4A           -------------------------
2e1dB           -------------------------
3e3cA           -------------------------
3bbjB           -------------------------
1dl3A           -------------------------
2ehpA           -------------------------
2cwwA           -------------------------
2cwnA           -------------------------
1e3aB           PMPFDKWYSASGYETTQDGPTGSL-
2c24A           DPFTV-WFSDIKITSE---------
3cq0A           -------------------------
2ao0A           -------------------------
2cwwB           -------------------------
2e12A           -------------------------
2cb6G           PNGEIPN------------------
2c24B           DPFTV-WFSDIKITSE---------
3dmyB           -------------------------
2asbA           IIDYDDDP-----------------
2djvA           -------------------------
3cqcB           -------------------------
3dwmA           -------------------------
1aq2A           -------------------------
3b77A           -------------------------
1d4gA           -------------------------
2cwnB           -------------------------