[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56286.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "2drrA.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3bmaD.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "3b5oA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "3dpnA.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "3bwnC.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "3bwoE.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "3bwoB.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "3bwoD.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "1ejjA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "3bwoF.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "3banA.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "2d3jA.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "3caeA.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "2c0rA.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "2bieA.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "1bjoA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "3bzsA.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "1dfoA.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "1btcA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "1bybA.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "1dy2A.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "1awiA.bssp"
#ERROR : Can't open dsspfile "3c01E.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "3c01F.bssp"

## Summary of PDB Search
:430
    4e-29  20%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-28  19%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    7e-28  20%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    4e-27  29%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-27  24%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    3e-26  29%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-25   9%  2drrA  [x.x.x] XYLANASE Y
    2e-25  18%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-25  20%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    7e-25  15%  1d2fA  [c.67.1] MALY PROTEIN
    1e-24  29%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-24  19%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-24   8%  3bmaD  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    5e-24  24%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    8e-24  18%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-23  19%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    3e-23  28%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    9e-23   9%  3b5oA  [x.x.x] CADD-LIKE PROTEIN OF UNKNOWN FUNCTION
    2e-22  31%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-22  19%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-22  15%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    2e-22  20%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-22  17%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-22  17%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    4e-22  17%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    6e-22  26%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    6e-22  31%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-21  26%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    3e-21  16%  1d2fB  [c.67.1] MALY PROTEIN
    6e-21  18%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    1e-20  13%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-20  21%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    2e-20  17%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-20  18%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-20  22%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-20  15%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    7e-20  16%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    9e-20  16%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-19  22%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-19  13%  1c7nA  [c.67.1] CYSTALYSIN
    3e-19   8%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    8e-19  14%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    8e-19  22%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-18  17%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-18  16%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-18   8%  3dpnA  [x.x.x] PROTEIN CT_858
    4e-18  12%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    4e-18   8%  1c8nA  [b.121.4] COAT PROTEIN
    5e-18  14%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-18  17%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-18  14%  3bwnC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-18  10%  1ax4A  [c.67.1] TRYPTOPHANASE
    9e-18  14%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-17  17%  3bwoE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-17  18%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-17  17%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-17  17%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-17  17%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-17  18%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-17  17%  3bwoB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-17  15%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    4e-17  18%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-17   8%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    4e-17  17%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-17  22%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    5e-17  17%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    7e-17  16%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-17   9%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    1e-16  13%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-16  17%  3bwoD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-16  11%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-16  12%  1ejjA  [c.76.1 - c.105.1] PHOSPHOGLYCERATE MUTASE
    2e-16  10%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    2e-16  17%  3bwoF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-16  16%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-16  16%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-16  19%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-16  12%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    4e-16  13%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-16  12%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    8e-16  16%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-16  16%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-16  16%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-16  17%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-15  14%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-15   9%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-15  22%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-15  16%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-15  16%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-15   9%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-15  15%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-15  16%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    4e-15  15%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    4e-15   9%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    4e-15  14%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    5e-15  17%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    5e-15  12%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    6e-15  16%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    6e-15   9%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-14  14%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    2e-14  14%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    2e-14  11%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    2e-14  11%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-14  17%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    3e-14   7%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-14   9%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-14  16%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-14  11%  1eg5A  [c.67.1] AMINOTRANSFERASE
    4e-14  10%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    5e-14   9%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    6e-14   9%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    1e-13  14%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    1e-13  12%  3banA  [x.x.x] D-MANNONATE DEHYDRATASE
    2e-13  17%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    2e-13  12%  1eg5B  [c.67.1] AMINOTRANSFERASE
    3e-13  11%  2d3jA  [x.x.x] WNT INHIBITORY FACTOR-1
    3e-13  12%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    3e-13  12%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    4e-13  12%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-13   9%  3caeA  [x.x.x] ENDODEOXYRIBONUCLEASE 1
    4e-13  16%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    4e-13  12%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-13  11%  1ecxB  [c.67.1] AMINOTRANSFERASE
    5e-13   8%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-13   9%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    5e-13  10%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    6e-13  13%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    7e-13  13%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    8e-13   7%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    8e-13  12%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    9e-13  10%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    1e-12  11%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-12  10%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    1e-12  15%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    1e-12  12%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    1e-12  12%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-12   9%  2c44C  [x.x.x] TRYPTOPHANASE
    2e-12   8%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    2e-12  12%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-12  12%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-12  16%  1ei7A  [a.24.5] COAT PROTEIN
    3e-12  12%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    5e-12   9%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-12  12%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    7e-12  11%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    7e-12   8%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    9e-12   9%  2c44B  [x.x.x] TRYPTOPHANASE
    9e-12  16%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    9e-12  13%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    3e-11   8%  2c0rA  [c.67.1 (1bt4A)] PHOSPHOSERINE AMINOTRANSFERASE
    3e-11   9%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    4e-11  17%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    8e-11  10%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    8e-11  12%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    9e-11  14%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    1e-10  11%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-10   7%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-10   9%  2bieA  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-10  12%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-10  14%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    3e-10  10%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    3e-10  19%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    4e-10  10%  3e9kA  [x.x.x] KYNURENINASE
    4e-10  14%  1ecxA  [c.67.1] AMINOTRANSFERASE
    4e-10  15%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    5e-10  12%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    7e-10  10%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    8e-10   9%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    9e-10  12%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    1e-09   9%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-09  13%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    1e-09   8%  1bjoA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-09  17%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    2e-09   9%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    2e-09  13%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    2e-09   9%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    3e-09  18%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    3e-09  12%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    4e-09  10%  2c44A  [x.x.x] TRYPTOPHANASE
    6e-09  15%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    8e-09  16%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    1e-08  12%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    1e-08  15%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    2e-08   8%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-08  11%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-08  10%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    4e-08  17%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    5e-08  12%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    9e-08  12%  2btwB  [x.x.x] ALR0975 PROTEIN
    1e-07  11%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-07  12%  3bzsA  [x.x.x] ESCU
    1e-07  16%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    2e-07   6%  2btwA  [x.x.x] ALR0975 PROTEIN
    5e-07  12%  1dfoA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    7e-07  14%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    7e-07  16%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-06  14%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-06  12%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-06  15%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-06  11%  1btcA  [x.x.x] BETA-AMYLASE
    2e-06  12%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    4e-06  14%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    7e-06  12%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    9e-06  13%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-05   5%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    2e-05  10%  1bybA  [x.x.x] BETA-AMYLASE
    3e-05  15%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-05  15%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-05   8%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    7e-05  10%  1dy2A  [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
    9e-05   7%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    4e-04  10%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    6e-04   9%  1awiA  [d.110.1] PROFILIN
    6e-04   9%  3c01E  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
    8e-04  27%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    8e-04   9%  3c01F  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
:430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
3ei6A           --GYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHESGYGAEQGAKPLRAAIAKT
3b46B           ---------LTNEAAAKNNNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPQYSPTRGRPSLINSLIKL
3dydA           ---------SVRPSDKVKPNPNKTMISLSIGDGNLPTDPEVTQAMKDSGKYNGYAPSIGFLSSREEIASY
1bjwA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKYAPPAGIPELREALAEK
2douB           -----SVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDYGYCLKSCTLPFLEEAARW
5bj4A           --------RGLSRRV-QAMKPGVDLVALTAGEPDFDTPEHVKEAARRALAQTKYAPPAGIPELREALAEK
2drrA           -----------GNLDVRTEGMSYGMMMAVQ-MDRKDIFDRIWNWTMKNMYMT-EGVHAGYFAWSCQPDGT
3ei9A           -AGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKIEGYSGYGAEQGAKPLRAAIAKT
3ei6B           --GYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMSTIEGYSGYGAEQGAKPLRAAIAKT
1d2fA           ------------------------LLPFTISDMDFATAPCIIEALNQRLMHVFGYSRWKNDEFLAAIAHW
5bj3A           ------------RGLSRRVQAMKPLVALTAGEPDFDTPEHVKEAARRALAQGKTAPPAGIPELREALAEK
3eiaA           -----FPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3bmaD           ---------------------------GAEKRSAVATTIDSQKVRALSDPNVRFVPFFGSSEWLRFDGAH
2douA           -----SVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEAPTTYGYCLKSCTLPFLEEAARW
3ei7A           -----FPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMATIEGYSGYGAEQGAKPLRAAIAKT
3dydB           ---------------DVKPNPNKTMISLSIGDGNLPTDPEVTQAMKDSGKYNGYAPSIGFLSSREEIASY
1b5pA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKYAPPAGIPELREALAEK
3b5oA           ------------------------------------LTKQLNQLLAQDYVAFSITENPVVQLSQASFAQI
1b5oA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRAQGKTKYAPPAGIPELREALAEK
3ei8A           -AGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMSTIEGYSGYGAEQGAKPLRAAIAKT
1ay4A           --QAPDKILALMGEFRADPRQGKIDLGVGVYKDATGIMRAVHAAEQETETTKTYAGLSGEPEFQKAMGEL
3ei7B           --GYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMATIEGYSGYGAEQGAKPLRAAIA-K
3ei9B           -AGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKIEGYSGYGAEQGAKPLRAAIAKT
3e2yA           --------------------ADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNYTRGFGHPALVKALSCL
3e2fA           --------------------ADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNYTRGFGHPALVKALSCL
1djuB           -------------ALSDRLELVSDVISLGIGEPDFDTPQHIKEYAKEDKGLTHYGPNIGLLELREAIAEK
1bkgA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKPPAGIPELREALAEK
1djuA           -----------------ELVSAKDVISLGIGEPDFDTPQHIKEYAKEALDKTHYGPNIGLLELREAIAEK
1d2fB           --------------------SKVVLLPFTISDMDFATAPCIIEALNQRLMHGVGYSRWKNDEFLAAIAHW
3b46A           -------SLTNEAAAKAANNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPMVNPTRGRPSLINSLIKL
2cstA           ------AVFKLTADFRDSRGVGAYRTDEGQPWVLPVVRKVEQLIAGDGSLNHEYLPILGLPEFRANASRI
1bw0A           -----NPIRTVSDN-AKPSPSPKPIIKLSVGDKNLLTSAAQIKKLKDSQECNGYFPTVGSPEAREAVATW
3cq4B           ----------ITLSDLPLREELRVDIRLNTNENPYPPSEALVADLVATVDK--IATELDAVELRDELAAY
3eiaB           -----FPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
2egyB           --IQASTIRELLKLTQRPGAGGLPAPELFPKEEA--AEAAARILREKGEVALQYSPTEGYAPLRAFVAEW
3bwnD           --------------------MSDFVVNLDHGDPTAYEEYWRKMGDMSYFSDMTNLCWFLEPELEDAIKDL
2d5yA           --APADPILGLADLFRADERPGKINLGIGVYKDETGVLTSVKKAEQYNETTKNYLGIDGIPEFGRCTQEL
7aatA           -----DPILGVTEAFKRDTNSKKMNLGVGAYRGKPYVLNCVRKAEAAKKMDKEYLPIAGLADFTRASAEL
2egyD           --IQASTIRELLKLTQRPGAGGLPAPELFPKEEA--AEAAARILREKGEVALQYSPTEGYAPLRAFVAEW
1c7nA           -----LGSLKWDLMYSQNPEVGNEVVPLSVADMEFKNPPELIEGLKKYLDETVLGYTGPTEEYKKTVKKW
3drdA           -------------------FSSVWLNVHGH-RKKELDDAIKKQLGKIAHSTLLGMTNVPATQLAETLI--
1ay5B           --LKPQAPDKILALMGEFGKIDLGVGVYKDATGHTPIMRAVHAAMLETETTKTYAGLSGEPEFQKAMGEL
3cbfA           --IQASTIRELLKLTQRPGAGGLPAPELFPKEEA--AEAAARILREKGEVALQYSPTEGYAPLRAFVAEW
3cq6A           ---------ELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVAIATELNRYPERDAVELRDEAAYI
2d61A           --APADPILGLADLLRADERPGKIDLGMGVYNDETGVLTSVKKAEQYNETTKNYLGIDGIPEFGRCTQEL
3dpnA           ----------------------------------------------------------------------
3d6kA           -------------AKYAELKAKNLSLDLTRGKPSADLSNDLLSLPGDGVDCRNYGGLLGIADIRELWAEA
1c8nA           ----------------------------------------------------------------------
2aatA           ---PADPILGLADLF--RADERPGKINLGIGVGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1aamA           ---PADPILGLADLF--RADERPGKINLGIGTGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
3bwnC           --------------------MSDFVVNLDHGDPTAYEEYWRKMGDRSYFSDMTNLCWFLEPELEDAIKDL
1ax4A           -------------------PSSAVYIDLLTDSGTNAMSDHQWAAMITGD--EAYAGSRNYYDLKDKAKEL
3bwoC           --------------------MSDFVVNLDHGDPTAYEEYWRKMGDRSYFSDMTNLCWFLEPELEDAKDLH
3bwoE           ------------------------VVNLDHGDPTAYEEYWRKMGDRCTVTIRGFSDMTNLCELEDAIKDL
3aatA           ---PADPILGLADLF--RADERPGKINLGIGTGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1bqaA           --APADPILGLADLF--RADERPGKINLGIGTGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1aheA           ---PADPILGLADLF--RADERPGKINLGIGTGKIPVLTSVKKAEQENETTKLYLGIDGIPEFGRCTQEL
1asfA           ---PADPILGLADLF--RADERPGKINLGIGVGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
2d64A           --APADPILGLADLLRADERPGKIDLGMGVYNDETGVLTSVKKAEQYNETTKNYLGIDGIPEFGRCTQEL
3bwoB           ------------------------VVNLDHGDPTAYEEYWRKMGDRCTVTIRGFSDMTNLCELEDAIKDL
1ay4B           ----LKPQLALMGEF--RADPRQGKIDLGVGVYKDPIMRAVHAAEQRTETTKTYAGLSGEPEFQKAMGEL
1akaA           -----DPILGVTEAFKRDTNSKKMNLGVGAYRDDNYVLNCVRKAEAAKKMDKEYLPIAGLADFTRASAEL
1cl1B           ------DTQLVNAG--RSKKYTLGAVNSVIQRASSLVFDSVEAKKHNGELFYGRRGTLTHFSLQQAMCEL
3cq5A           ITLSDLPLREELRGEHAYGPQLNVDIRLNTNENPYPPSEALVADLVKIATELNRYPERDAVELRDELAAY
2egyC           -------------------AGGLPAPELFPKEEA--AEAAARILREKGEVALQYSPTEGYAPLRAFVAEW
3dc1D           -------------------AGGLPNPNMFPFKITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQL
1asbA           --APADPILGLADLFRADERPGKINLGIGVYKDETGVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1cl1A           ------DTQLVNAGRSKKYTLGAVNSVRASSLVFDSVEAKKHATRNNGELFYGRRGTLTHFSLQQAMCEL
2bwnD           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEGAGSGGTRNISGTTAYHRRLE--
3bwoD           ------------------------VVNLDHGDPTAYEEYWRKMGDRCTVTIRGFSDMTNLCELEDAIKDL
3bv0B           -------------------MSSWWTAIHGH-GHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDI
1ejjA           ----------------------------------------------------------------------
1agxA           ------TMEETAFFLNLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAASSNEAKNKGVMVLMNDSIFAA
3bwoF           ------------------------VVNLDHGDPTAYEEYWRKMGDRCTVTIRGFSDMTNLCELEDAIKDL
1arhA           ----ADPILGLADLFRADERPGKINLGIGVYKDETGVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1czcA           --APADPILGLADLLRADERPGKIDLGMGVYNDETGVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
3cq4A           ----------ITLSDLPLREELRVDIRLNTNENPYPPSEALVADLVATVD-KIATELRDAVELRDELAAY
3d6kC           -------------------TRGKPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEA
1ajsA           -QAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCVRKVEQRIANNSSLNHEYLPILGLAEFRTCSRLA
3d6kD           -------------------TRGKPSAEQLDLSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEA
1bqdA           ---PADPILGLADLFRADERPGKINLGIGVYKDETGVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
3bwnB           -------------NIPMSDF----VVNLDHGDPTAYEEYWRKMGDRCTVTIMTNLCWFLEPELEDAIKDL
1aiaA           ---PADPILGLADLF--RADERPGKINLGIGVGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
3cq5B           MTSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLDKIATELNRYPERDAVELRDELAAY
3bwoA           ----------------KNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIMTNLCWFLEPELEDAIKDL
1dtyA           -------------------------------------------AMTPQPLECVFLADSGSVAVEVAMKMA
1bw0B           -----NPIRTVSDN-AKPSPSPKPIIKLSVGDKNLLTSAAQIKKLKDSQECNGYFPTVGSPEAREAVATW
3bwnE           ------------------------VVNLDHGDPTAYEEYWRKMGDRGCDLMSYFSDMTNLCELEDAIKDL
3bwnA           --------------------MSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGNLCWFLEPELEDAIKDL
3bcaA           -----TLELFLHELAVMDSNNFLGNCGVGEREGRVALVARRHYRFIHGIGQPKAAGSSLLNKITNSLVLN
1ariA           --APADPILGLADLFRADERPGKINLGIGVYTGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
3dc1B           MNYARFITAASAARNPSPIRGPKSMISLAGGLPNPNMKTAVITVEEMMKRALQYSPSAGIPELLSWLKQL
3dzzA           ------------------------ELPWIAEDFKIAPEIASEEKL----KVAAFGYESVPAEYYKAVADW
3cogB           --------FLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFGAPGQHSGFEYSRSGNPTRNCLEKA
2e7uA           -------------------VMSWGPLILG------HAHPKVLARVTLERGLTFGAPSPLEVALAKKVKRA
1b8gB           -------------------GLAENQLCFDLLESWLAKNPAFKKNGESIFAEALFQDYHGLPAFKKAMVDF
2bwnB           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEGAGSGGTRNISGTTAYHRRLE--
2d66A           --APADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKENETTKNYLGIDGIPEFGRCTQEL
2dgmB           -----RDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMDLSINKNDKEEYPQSAAIDLRCVNM
1b8gA           -----LGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFEAAAFKKNGESIFAALFQDYHGLPAFKKAMVDF
2eh6A           -----------------YDEEGKEYLDFVSGIGVNSLGHALKEQVEKLLHVSNLYENPWQEELAHKLVKH
1c7gA           --------------------AGYNTFLLNSKDIYIDLTDSGTNAMSDMIGDEAYAGSENFYHLEKTVKEL
3cogD           --------------------------PEQWTSRAVVPPISLSTTFGAPGQHSGFEYSRSGNPTRNCLEKA
3dc1A           -----ARFITAASAARNPSPGPKSMISLAGGLPNMFPFKTAVITVENGKTILQYSPSAGIPELLSWLKQL
2bhxB           -----------------------QVFNFNAGPS--ALPKPALERAQQMSVMELSHRSQSYEEVHEQAQNL
2dgmC           --HEMRDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMDWIDKEEYPQSAAIDLRCVNMVA--
1b4xA           ---PADPILGLADLF--RADERPGKINLGIGTGKTPVLTSVKKAEQYNETTKNYLGIDGIPEFGRCTQEL
1eg5A           ---------------------------FDNNATT-RVDDRVLEEIVEKYGNPNSAHGGIEANLHEKAREK
2aevA           ---------IILEILNEKGRDAL------YDLSGLSGGFLIDEKDKALLNT-YIGSSYFAEKVNEYGLKH
2dgmE           -----RDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMNWIDKEEYPQSAAIDLRCVNMVADL
2ch2A           ---------------------------IMMGPGPSNCSKRVLTAMT---NTVLSNFHAELFRTMDEVKDG
1dgdA           --------------------DGRAILDFTSGQMSAVLHPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATR
3banA           ----------------------------------------------------------------------
1arsA           ---PADPILGLADLF--RADERPGKINLGIGTGKTPVLTSVKKAEQENETTKNYLGIDGIPEFGRCTQEL
1eg5B           ---------------------------FDNNATT-RVDDRVLEEIVFYREKYGPNSAHGGIEANLHKARE
2d3jA           -----HQARVLIGFEEDILIVS--EGKMAPFTHDFRKAQQRMPAIPVNIHSNFTWQAAGQAEYFYELSLR
2dkjA           ----------LFELIALEEKRQREGLELIASEVSKQVREAVGSVLTNKYAEPGARYYGGCEVIDRVESLA
3dxvA           -----------------------------------------------GATILSASNAPAVTLAERLLA--
1ajrA           -QAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVEQRIANNSSLNHEYLPILGLAEFRTCASRL
3caeA           ----------------------------------------------------------------------
3bwnF           ------------------------VVNLDHGDPTAYEEYWRKMGDRSYFSDMTNLCWFLEPELEDAIKDL
2bwnA           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEGAGSGGTRNISGTTAYHRRLEAE
1ecxB           ---------------------------NATTRVDDRVLEEMIVFYREKYGNSAHGMGIEANLHMEKAREK
3bcbA           ----------------------------------------------------KAAGSSLLNKITNSLVLN
3b8xB           ------------------------MINYPLASSTWD--DLEYKAIQSVLDSKMFTMGEYVKQYETQFAKT
2e7jA           -----------------------------INIDPLQTGGKLTEEAR----QALLEWPPIHDFIHNQLPKF
2bwoA           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEALEAVGAGSGGGTTAYHRRLEAE
3dxvB           --------------------------PAGATILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAA
2bkwA           --------------------------DTLLIPGPIILSGAVQKALDVPS--LGHTSPEFVSIFQRVLKNT
2bwpA           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEGAGSGGTRNISGTTAYHRRLE--
2aeuA           ---------IILEILNEKGRDAL------YDLSGLSGGFLIDEKDKALLNT-YIGSSYFAEKVNEYGLKH
2dgkC           --HEMRDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMDINKNWIDKEEYPQSAAIDLRCVNM
1c4kA           ---------------------KHPAGREFYDFFG-ETVFRADLCNADVALGDLLIHEGPAVAAEKHAARV
2c7tA           ------------------------------HWPEWPHSDRTRRKIEQSNRWAISGYWTGEESMERKFAKA
2a7vA           ----------------------------WTGQESLDSDPEMWELLQRDRQCRGLELIASENFCSRAALEL
2dr1B           ---------------------------KLFTAGPVACFPEVLEIMKVQMFSRSKEYRKVHMDTVERLREF
2c44C           -------------------DSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAYSGSR--SYYALAESVKNI
2ch1A           ------------------------------GPGPSNCSKRVLTAMT---NTVLSNFHAELFRTMDEVKDG
2dr1A           --------------------------YKLFTAGPVACFPEVLEIMKVQMFSRSKEYRKVHMDTVERLR--
2bwoD           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEALEAVGAGGTRNISGTTAYHRRL
1ei7A           ----------------------------------------------------------------------
3d6kB           -------------------TRGKPSAEQL------DLSNDLLSLPGDGVDCRNYGGLLGIADIRELWAEA
3bc8A           -----------------------------------ALVARRHYRFIHGIGRPKAAGSSLLNKITNSLVLN
2e54A           -----------------YDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMEL
2dgmA           -----RDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMDLSINKNDKEEYPQSAAIDLRCVNM
3b8xA           ---------------------------YPLASSTWD--DLEYKAIQSVLDSKMFTMGEYVKQYETQFAKT
2c44B           -------------------DSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEA--YSGSRSYYALAESVKNI
3dzzB           ------------------------ELPWIAEDF--KIAPEIASEEKLKVAA--FGYESVPAEYYKAVADW
1d7uA           -----------------YDADGRAILDFTSGQMSAVLHPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATR
2c0rA           ---------------------------AGPAALPLEVLERAQAEFVDYQHTEMSHRGAVYEAVHNEAQAR
1e5eB           ----------------ACIHANPQKDQFGAAITSTFVFDNCQQGGNFAGQESGYIYTRLGNPTVSNLEGK
3bn1A           --------------------------RISVAAPRLD-GNERDYVLECMDTTWISSVGRFIVEFEKAFADY
3e77A           ---------------------------FQSMLPH-SVLLEIQKELLDYKGVEMSHRSSDFAKIINNTENL
2bwnE           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDYGMGQHPVVLAAMHEALEAVGAGSGGTISGTTAYHRRL
1c0nA           -----------------REVNGLPLAYLDSAASAQKPSQVIDAEAEFAVHAGAHTLSAQATEKMENVRKR
3bs8A           ---------------------GNEYIDYVLSWGPLIGHTNDRVVESLKKTSFGAPTEVENELAKLVIDRV
2bieB           -----------------------------------ALPKPALERAQQMSVMELSHRSQSYEEVHEQAQNL
2bieA           -----------------------------------ALPKPALERAQQMSVMELSHRSQSYEEVHEQAQNL
2bwoB           -DIEREKGAFPKAQWNRPDGGKQDITVWCGNDLGMGQHPVVLAAMAVGAGSGGTRNISGTTAYHRRLE--
1cs1A           --------------------------------SGLNDDEQYGCVVP----PIHLSSTYNFTGFNEPRAHD
2c81A           -----------------------------------QHSDRTRRKIEQSNRWAISGYWTGEESMERKFAKA
3dr4C           ----------------------LPRISVAAPRLDGNERDYVLECMDTTW---ISSVGRFIVEFEKAFADY
3e9kA           REFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEEIAAYGHEVGKRPWITGDESIVGL
1ecxA           -----------------------------------RVDDRVLEEMIVFYRESAHGMGIEANLHMEKAREK
1b9hA           -----------------------------------PAWPQYDDAERLEQGQWWRMGGDEVNSFEREFAAH
3bcxB           ---------------------GKSVVPPSGKV----IGTKELQLMVEASLDGWLTTGRFNDAFEKKLGEY
3e77B           ---------------------------FQSM-LPHSVLLEIQKELLDYKGVGISHRSSDFAKIINNTENL
3e77C           ---------------------------FQSMLPH-SVLLEIQKELLDYKGVEMSHRSSDFAKIINNTENL
3bcxA           ---------------------GKSVVPPSGKVIG----TKELQLMVEASLDGWLTTGRFNDAFEKKGEYL
2dgkA           --HEMRDDVAFQIINDELYLDGNARQNLATFCQT-WDDENVHKLMDWIDKEEYPQSAAIDLRCVNMVADL
2cb1A           ----------------------------------------------------------------------
1bjoA           ---------------------------SGPAMLPAEVLKQAQQELRDWNGLGTSHRGKEFIQVAEEAEDF
3bn1D           ----------------------------------------ERDYVLEMDTTWISSVGRFIVEFEKAFADY
3bh1C           ----------------------------------------------------------------------
3bb8A           ---------------------GKSVVPPSGKV----IGTKELQLMVEASLDGWLTTGRFNDAFEKKLGEY
1e5eA           ----------------ACIHANPQKDQFGAAIPPIFVFDNCQQGGNFAGQESGYIYTRLGNPTVSNLEGK
3bn1C           ---------------------------ISVAAPRLD-GNERDYVLECMDTTWISSVGRFIVEFEKAFADY
2cfbA           ------------------DVDGNQYIDYVGSWGPAIVHPEVIDALHAALEKGTSFGAPCLLENILAEMVI
2c44A           -------------------DSEDVFIDLLTDSGTGAVTQSMQAAMMRGDE--AYSGSRSYYALAESVKNI
2cy8A           -----NDYKRKTEGSVFWAQRARSVMPDGAFDPHGLFISDAQGVHKTDVDGNVYLDFFGHPRVNAAIAEA
2ctzA           ------ETLQLHAGYEPEPTTLSRQVPIYPTTS--YVFKSPEHANLFALKEFGNIYSRIMNPTVDV----
1dfoB           -----------------QEKVRQEEHIELIASEN-YTSPRVMQAQGSQLTNPGKRYYGGCEYVDIVEQLA
3dr7B           ---------------------------ISVAAPRLD--GNERDYVLEMDTTWISSVGRFIVEFEKAFADY
1bjnA           ---------------------------SGPAMLPAEVLKQAQQELRDWNGLEVSHRGKEFIQVAEEAEKF
1bj4A           -----EVYNIIKKESNRQRVGLELIASENFASRAVALGSCLNNKYSEGYPGQYYGGTEFIDELETLCQKR
1ejiA           --------------------------------------SLNNKYSEGYPGQRYYGGTEFIDELELCQKRA
2byjA           -------------------------------------HPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEY
3ecdC           ----------------------------PFFSQSLERDASVRGAILKELERQQSQLIASENIVSRAVLDA
2btwB           ----------------------------------------------------------------------
3ecdB           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           ----------VARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLD
2btwA           ----------------------------------------------------------------------
1dfoA           -------------QAMEQEKVRQEEHIELIASEN-YTSPRVMQAQGGYPGKRYYGGCEYVDIVEQLAIDR
3dr4B           ---------------------------ISVAAP--RLDGNERDYVLEMDTTWISSVGRFIVEFEKAFADY
3bv0A           -------------------------------------HPALDQALTTQLRVMNHVMFGGLTHEPAARLAK
3dr4D           ---------------------------ISVAAPRLD--GNERDYVLEMDTTWISSVGRFIVEFEKAFADY
3ecdD           -------------------ANPFFSQSLA------ERDASVRGAILKERQQSQVELIASENIVSRAVLDA
1b9iA           ----------------------------------------ERNGLVRALEQGWRMGGDEVNSFEREFAAH
1btcA           ----------------------------------------------------------------------
3ecdA           -----------------------------------ERDASVRGAILKELERQQSQVSRAVLDAQGSVLTN
3e6gD           ------------------------------------------------------------FAYERCVAAL
3e6gB           ----------------------------------------------------------------------
2bwpB           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
1bybA           ----------------------------------------------------------GIIELKGPKQYD
1cj0A           ----------------------------------------------------------------------
3dr4A           ----------------------------------------ERDYVLEMDTTWISSVGRFIVEFEKAFADY
3bh1A           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1awiA           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
3ei6A           F-YGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIADPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
3b46B           YSPINTELKAENVTVTTGANEGILSCLMGLGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRN
3dydA           YHCPEAPLEAKDVILTSGCSQAIDLCLAVLGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDL
1bjwA           FRREGLSVTPEETIVTVGGKQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
2douB           YEGRVGLDPRREALALIGSQEGLAHLLLALTEPLLLPEVAYPSYFGAARVASLRTFLIPLRE--DGLADL
5bj4A           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
2drrA           KNSWGPAPDGEEYFALNYSEQARKLLHTCVHNGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSL
3ei9A           FYGGL-GIGDDDVFVSDGAKCDISRLQVMFGSNIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
3ei6B           F-YGGLGIGDDDVFVSDGAKCDISRLMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
1d2fA           FSTQYTAIDSQTVVYGPSVIYMVSELIRQWGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADWFCDM
5bj3A           FRREGLSVTPEETIVTVGGSQALFNLILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
3eiaA           F-YGGLGIGDDDVFVSDGAKCDISQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
3bmaD           PAVLAYNRSYRPYLLGQGGAASLNQYFGMQKQVVYVISPQWFSKNGYDPAAFQQYFNGDQLT---SFLKH
2douA           YEGRVGLDPRREALALIGSQEGLAHLLLALTEPLLLPEVAYPSYFGAARVASLRTFLIPLRE--DGLADL
3ei7A           FYGGL-GIGDDDVFVSDGAKCDISQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
3dydB           YHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDL
1b5pA           FRREGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMAGGVVVEVETLPEEGFVPDP
3b5oA           AYVQQYSIFPKVGFTELARRKALGAGWNGVAQENIDEEGSTTGGISHYTLLADGLEEGLGVAVKNTPSVA
1b5oA           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
3ei8A           FYGG-LGIGDDDVFVSDGAKCDISRLQVMFGSNIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
1ay4A           ILGDGLKSETTATLATVGGTGLELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDF
3ei7B           TFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
3ei9B           FYGGL-GIGDDDVFVSDGAKCDISRLMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYM
3e2yA           YGKIRQIDPNEEILVAVGAYGSLFNSIQGLVDPVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGTSS
3e2fA           YGKIRQIDPNEEILVAVGAYGSLFNSIQGLGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKW
1djuB           LKKQIEADPKTEIMVLLGANQAFLMGLSAFLKDVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNV
1bkgA           FRREGLSVTPEETIVTVGGKQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1djuA           LKKQIEADPKTEIMVLLGANQAFLMGLSAFGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNV
1d2fB           FSTQYTAIDSQTVVYGPSVIYMVSELWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKADGWFCDM
3b46A           YSPINTELKAENVTVTTGANEGILSCLMGLLNAGDVFEPFFDQYIPNIELCGGKVVYVPKELDQRNTRGE
2cstA           ALGDDSPAKRVGSVQGLGGTGALRIGAEFLRATVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLL
1bw0A           WRNSKSTIVKDNVVLCSGGSHGILMAITAICDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
3cq4B           ITQTGVAVTRDNLWAANGSNEILQQLFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSR-------GAD
3eiaB           FYGGL-GIGDDDVFVSDGAKCDISQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYR
2egyB           -----IGVRPEEVLITTGSQQALDLVGKVFGSPVLLEAPSYMGAIQAFRLQGPRFLTVPA-GEEGPDLDA
3bwnD           HGVVNAATEDRYIVVGTGSTQLCQAAVHAQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWG------
2d5yA           LFGKLINDKRARTAQTPGGTAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
7aatA           ALGESGRYVTVQGISGTGSLRVGANFLQRFFKFVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDF
2egyD           I-----GVRPEEVLITTGSQQALDLVGKVFGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGE-------E
1c7nA           MKDRQWDIQTDWIINTAGVVPNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELEKDGYYTIDF
3drdA           ---DISPKKLTRVFYSDSGAEAMEIALKMAWKNIGKPEKQKFIAMKSYKAPIPYVYRSESGDPDECRDQC
1ay5B           ILGDGSETTATLATVGGTGALRQALELARMANRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDF
3cbfA           I-----GVRPEEVLITTGSQQALDLVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPA-------GEE
3cq6A           TKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPALGFQPSYSMHPILAKGTHTEFIAVSRGA-DFRIDMD
2d61A           LFGKLINDKRARTAQTPGGTGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
3dpnA           ----------------------------------------------------------------------
3d6kA           LGLDGSSLNIFDLISWSYTWGNNDSSRPWSAEKWLCPVPGYDRHFTITEHFGFEINVPTDEG-----PDG
1c8nA           ------------LTPIALAYTVQSLPLIATQPALGTIADNYSKWRWVSLRIIYSPKCPTT-TSGTVAMCL
2aatA           LFGKLINDKRARTAQTPGGVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1aamA           LFGKLINDKRARTAQTPGGTGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
3bwnC           HGVVNAATEDRYIVVGTGSTQLCQAAARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWE-----------
1ax4A           FNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAVFISNFHFDTTAAHVELNGCKAINIVTEKAFDSETYI
3bwoC           GVVGNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWEG----------
3bwoE           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWEG----------
3aatA           LFGKLINDKRARTAQTPGGTGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1bqaA           LFGKNDKRARTAQTPGGTGALRVAADFLAKVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1aheA           LFGKLINDKRARTAQTPGGSGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1asfA           LFGKLINDKRARTAQTPGGTGALRVAADFLAKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
2d64A           LFGKLINDKRARTAQTPGGTGAVAADFLAKSVKRVWVSPGWPTHKSVFNSAGLEVREYAYYDAENHTLDF
3bwoB           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWEG----------
1ay4B           ILGDGSETTATLATVGGTGALRQALELARMANRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDF
1akaA           ALGESGRYVTVQGISGTGSLRVGANFLQRFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDF
1cl1B           -----EGGAGCVLFPCGAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDP---LIG
3cq5A           IKQTGVAVTRDNLWAANGSNEILQQLLQAFGRTALGFQPSYSMHPILAKGTHTEFIAVSR-GADFRIDMD
2egyC           I-----GVRPEEVLITTGSQQALDLVGKVFLDEGSLEAPSYMGAIQAFRLQGPRFLTVPA-------GEE
3dc1D           QIKLPPSQGQMDLCVTSGSQQGLCKVFEMIGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSL
1asbA           LFGKLINDKRARTAQTPGGTGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1cl1A           E-------GGAGCVLFPCGAAAVANSILAFGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWF---DPLIG
2bwnD           -AEIAGLHQKEAALVFSSAYNANDATLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIF-RHNDVAHLR
3bwoD           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWE-----------
3bv0B           AAKMALQYWRGRGLPGKRRLMTWRGGYHGDTFLICDPHGGMHSLWTDVLAAQVFAPQVPRDYDPAYSAAF
1ejjA           ---------------------------------------------------ALRDETYGNAVAQANKPNF
1agxA           RDVTKGINIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIVYGSDNM-MP
3bwoF           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWE-----------
1arhA           LFGKLINDKRARTAQTPGGTGALRVAADFLVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1czcA           LFGALINDKRARTAQTPGGTGALRVAADFLVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
3cq4A           ITQTGVAVTRDNLWAANGSNEILQQLLQAFGRTALGFQPSYSMHPILAKGTHTEFIAVS-------RGAD
3d6kC           LGLPGSSLNIFDLISWSYTWGNNDSSRPWSKVKWLCPVPGYDRHFTITEHFGFEINVPTDEG-----PDG
1ajsA           LGDDSPALQEKRVGALRIGAEFLARWYNGTNNKVYVSSPTWENHNGVFTTAGFKDIRSYYWDTEKRGLDL
3d6kD           LGLPGSSLNIFDLISWSYTWGNNDSSRPWSAEEWLCPVPGYDRHFTITEHFGFEINVPTDEGPD------
1bqdA           LFGKNDKRARTAQTPGGTGALRVAADFLAKNTSVWVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDF
3bwnB           HGVVNAATEDRYIVVGTGSTQLCQAAVHAQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGP
1aiaA           LFGKLINDKRARTAQTPGGTGALRVAADFLAKNTSVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
3cq5B           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRI-DMD
3bwoA           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGP
1dtyA           LQYWAKGEARDRFLTFRNGYHGDTFGAMSVDNSMHSLWKGYLPENLFAPAPQSRMDGEWD---ERDMVGF
1bw0B           WRNSKSTIVKDNVVLCSGGSHGILMAITAICDAGDVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
3bwnE           HGVVNAATEDRYIVVGTGSTQLCQAAVHALPVSVVAAAPFYSTYVEETTYVRSGMYKWEG----------
3bwnA           HGVVNAATEDRYIVVGTGSTQLCQAAVHALSSLVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGP
3bcaA           VKLAGVHSVASCFVVPMATGMSLTLCFLTLAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTL
1ariA           LFGKSALINDKRARTAQTPGGAADFLAKNTSVKVWVSNPSHPNHKSVFNSAGLEVREYAYYDAENHTLDF
3dc1B           QIHYPPSQGQMDLCVTSGSQQGLCKVFEMIGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSL
3dzzA           EEIERARPKEDWCVFASGVVPAISAVRQFTSDQILVQEPVYNFYSVIEGNGRRVISSDLIYENSKYSVNW
3cogB           VAAL----DGAKYCLAFASGLAATVTITHLGDQIICMDDVYGGTNRYFRQVASEFGLKISFV---DCSKI
2e7uA           YPFVTEATMSALRLARGYTGRPYIVKFRGNHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDP
1b8gB           MAEIKVTFDPNHLVLTAGATSANETFIFCLGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSGFQITE
2bwnB           -AEIAGLHQKEAALVFSSAYNANDATLSTLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDV-AHLR
2d66A           LFGKLINDKRARTAQTPGGTGALRVAADFLAKNTSVKNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDF
2dgmB           VADLHAPAPKNGTNTIGSSEACMLGGMAMTDKPNLVCGPVQICWHKFARYWDVELREIPM-RPGQLFMDP
1b8gA           MAEIKVTFDPNHLVLTAGATSANETFIFCLGEAVLIPTPYYPGFDRDLKWRTGVEIVPHCTSSNGFQITE
2eh6A           FWTEKVFFANSGTESVEAAIKLARKYWRDKGKKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSY
1c7gA           FGF-------KHIVPTHQGRGAENLLSQLAGQYVAGNMYFTTTRFHQEKNGATFVDIVRDEAHDASLNLP
3cogD           VAA--LDGAKYCLAFASGLAATVTITHLLKAGDQICMDDVYGGTNRYFRQVASEFGLKISFV---DCSKI
3dc1A           QIHYPPSQGQMDLCVTSGSQQGLCKVFEMIGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSL
2bhxB           LRELQIPNDYQILFLQGGASLQFTMLPMNLLTKGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSI
2dgmC           -DLWHAPAPKNGQAVGTNTIGSSEACMLGGMAPNLVCGPVQICWHKFARYWDVELREIPM-RPGQLFMDP
1b4xA           LFGKLINDKRARTAQTPGGTGADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1eg5A           VAKV-LGVSPSEIFFTSCATESINWILKTVKRTIITTPIEHKAVLETKYLSKGFKVKYVPVDS-RGVVKL
2aevA           LGGD----ENDKCVGFNRTSSAILATILALKPKHYLPELPGHPSIERSCKIVNAKYFESDKVGE------
2dgmE           WHAPAPKNGQAVGTNTIGSSEACMLGGMAMDKPNLVCGPVQICWHKFARYWDVELREIPM-RPGQLFMDP
2ch2A           LRYIFQTENRATMCVSGSAHAGMEAMLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSL
1dgdA           LANI-TPPGLDRALLLSTGAESNEAAIRMAGRKVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAF
3banA           ---------------------------------------------------------------------P
1arsA           LFGKLINDKRARTAQTPGALRVAADFLAKNVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDF
1eg5B           KVAKVLGVSPSEIFFTSCATESINWILKTRKRTIITTPIEHKAVLETKYLSKGFKVKY--------VPVD
2d3jA           SLDKGIMADPTVNVPLLGTVPHKASVVQVGQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFK--------
2dkjA           IERKALFGAAWANVQPHSGSQANMAVYMALGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTE
3dxvA           ---SFPGEGTHKIWFGHSGSDANEAAYRAIRSGVIAFAGAYHGCTVGSMAFSGLILLPYPDPYRDPTGDA
1ajrA           ALGDSPALQEKRVGGVQSLGGTLARWYNGTNNKVYVSSPTWENHNGVFTTAGFKDIRSYRYWDEKRGLDL
3caeA           ----GLEDKVSKQLESKGIKFEYEEWKVPYSQQNYSSH----TYTPDFLLPNGIFVETKGLWESDDRKKH
3bwnF           HGVVNAATEDRYIVVGTGSTQLCQAAVHALSSLVVAAAPFYSTYVEETTYVRSGMYKWEGDAWG------
2bwnA           IAG---LHQKEAALVFSSAYNANDATLSTLRVLLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVA-HLR
1ecxB           V-AKVLGVSPSEIFFTSCATESINWILKTVKRTIITTPIEHKAVLETMKYLSMKGFKVKYVP-----VDS
3bcbA           VIKLGVHSVASCFVVPMATGMSLTLCFLTLRHKIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGELRTDL
3b8xB           FGSKYAVMVSSGSTANLLMIAALFFTKKPRLKKIIVPAVSWSTTYYPLQQYGLRVKFVDIDI-NTLNIDI
2e7jA           -------LGCDVARVTNGAREAKFAVMHSLAAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITP
2bwoA           IAG---LHQKEAALVFSSAYNANDATLSTLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRH-NDVAHLR
3dxvB           YRAIVKATGRSGVIAFAGAYHVGSMAFSGHSVQADAAKADGLIL---------LPYPDPYRPYRNDTGDA
2bkwA           RAVSAAASKSQPFVLAGSGTLGWDIFASNFPNKNVLVGTFSDRFADCLRSYGAQVDVVRPLKIGESVPLE
2bwpA           -AEIAGLHQKEAALVFSSAYNANDATLSTLRPGLIIYSDSLNHASMIEGIKRNAGPKRIF-RHNDVAHLR
2aeuA           LG--GDENDKCVGFNRTSSAILATILALKPKKVIHYLPELPGHPSIERSCKIVNAKYFE-------SDKV
2dgkC           VADLHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWVCGPVQICWHKFARYWDVELREIPMRP-GQLFMDP
1c4kA           YNA------DKTYFVLGGSSNANNTVLVSNGDLVLFDRNNHKSVYNSALAMAGGRPVYLQTNRNPYEKKI
2c7tA           FAD--FNGVPYCVPTTSGSTALMLALEALGEGDEVIPSLTWIATATAVLNVNALPVFVDVEADTYCIDP-
2a7vA           GSCLNNKYSEGVDEIELLCQRRALEAFDLDPAQNVQPYSGSPANLAVYTALLQPHDRIMGYKLNPKTGLI
2dr1B           LEVEKGEVLL-VPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKP
2c44C           FYQYTIPTHQGRGAEQIYIPLIKKREQEKGSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRL
2ch1A           LRYIFQTENRATMCVSGSAHAGMEAMLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSL
2dr1A           -EFLEVEKGEVLLVPSSGTGIMSIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKP
2bwoD           EAEIAGLHQKEAALVFSSAYNANDATLSTLRVLLIIYSDSLNHASMIEGIKRNAGPKRIF-RHNDVAHLR
1ei7A           --------------------------------------EVWKPSPQVTVRFPDSDFKVYRYNA-VLDPLV
3d6kB           LGLPASSLNIFDLISWSYTWGNNDSSRPWSAEEKVCPVPGYDRHFTITEHFGFEINVPTDEG-----PDG
3bc8A           VKLAGVHSVASCFVVPMATGMSLTLCFLTLAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEDELRTDL
2e54A           AELLSKNTFGGKVFFANTGTEANEAAIKIARYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEY
2dgmA           VADLHAPAPKNGQAVGTNTIGSSEACMLGGMAPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPK
3b8xA           FGSKYAVMVSSGSTANLLMIAALFFTKKPRLKEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIE
2c44B           FYQYTIPTHQGRGAEQIYIPVLIKKREQEKSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRL
3dzzB           EEIERARPKEDWCVFASGVVPAISAVRQFTSDQILVQEPVYNFYSVIEGNGRRVISSDLIYENSKYSVNW
1d7uA           LANI-TPPGLDRALLLSTGAESNEAAIRMAKLVVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAF
2c0rA           LLALGNPTGYKVLFIQGGASTQFAMIPMNFGQTANYVMTGSWASKALKEAKLIGDTHVAASSEASNYMTL
1e5eB           IAFL---EKTEACVATSSGMGAIAATVLTIGDHLISDECLYGCTHALFEHALTKFGIQVDFINT---AIP
3bn1A           CGVK------HAIACNNGTTALHLALVAMGGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTF-NLDA
3e77A           VRELAVPDNYKVIFLQGGGCGQFSAVPLNLIRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIP
2bwnE           EAEIAGLHQKEAALVFSSAYNANDATLSTLRVGLIIYSDSLNHASMIEGIKRNAGPKRIF-RHNDVAHLR
1c0nA           ALFINARSAEELVFVRGTTEGINLVANSWGGDNIIISQMEHHANIVPWQMLCARVGAELRVIP----LNP
3bs8A           PSVEVRMVSSGRLARGYTGRNKILKFEGCYHGHKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVK
2bieB           LRELQIPNDYQILFLQGGASLQFTMLPMNLLTKGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSI
2bieA           RELLQIPNDYQILFLQGGASLQFTMLPMNLGTIGNYVLTGSWSKALKEAKLLGETHIAASTKANSYQSIP
2bwoB           -AEIAGLHQKEAALVFSSAYNANDATLSTLRVGLIIYSDSLNHASMIEGIKRNAGPKRIF-RHNDVAHLR
1cs1A           YSRRGNPTRDVVAVLTNTGMSAIHLVTTVFGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQ---GDE
2c81A           FAD--FNGVPYCVPTTSGSTALMLALEALGIGEGDEVIVPSLTW-------IATATAVLNVNALPVFVDV
3dr4C           CGVK------HAIACNNGTTALHLALVAMPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFN-LDA
3e9kA           MKDI-VGANEKEIALMNALTVNLHLLMLSFRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPRE
1ecxA           VAKV-LGVSPSEIFFTSCATESINWILKTVKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDRGVVKL
1b9hA           HGA------AHALAVTNGTHALELALQVMGVGEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNL-DP
3bcxB           LGVPYVLTSANLLALTALTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDI-PTYNVNA
3e77B           VRELAVPDNYKVIFLQGGGCGQFSAVPLNLGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIP
3e77C           VRELAVPDNYKVIFLQGGGCGQFSAVPLNLGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIP
3bcxA           GVPYVLTTSANLLALTALTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDI-PTYNVNA
2dgkA           WHAPAPKNGQAVGTNTIGSSEACMLGGMAMDKPNLVCGPVQICWHKFARYWDVELREIPM-RPGQLFMDP
2cb1A           -------------------------------GDVVAAKGLFGQTIGLFGQVLSLMGVTVR----YVDPEP
1bjoA           RDLLNVPSNYKVLFCHGGGRGQFAAVPLNDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRA
3bn1D           CGV------KHAIACNNGTTALHLALGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDN-DPRTFNLDA
3bh1C           ------------VVEPARQVEERTSCAIELVDGSIITGATSDLLGCSSSMLLNALKHLAGIDDAIHLLSP
3bb8A           LGVPYVLTSANLLALTALTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDI-PTYNVNA
1e5eA           IAFL---EKTEACVATSSGMGAIAATVLTIGDHLISDECLYGCTHALFEHALTKFGIQVDFINT---AIP
3bn1C           CGV------KHAIACNNGTTALHLALVIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDP-RTFNLDA
2cfbA           AAVPS----VEMVRFVNSGTEACMAVLRL-------MRAYTQREKVIKFEGCYHGHAATLTAPYNDLEAV
2c44A           FYQYTIPTHQGRAEQIYIPVLIKKREQEKGSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRL
2cy8A           LSHGAASHPLEVRWAEPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGTTANTLL-IRPDDIEGM
2ctzA           LEKRLAALEAALATASGHAAQFLALTTLAQAGDIVSTPNLYGGTFNQFKVTLKRLGIEVR--FTSREERP
1dfoB           IDRKELFGADYANVQPHSGSQANFAVLLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVP----YGID
3dr7B           -----CGVKHAIACNNGTTALHLVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDP-RTFNLDA
1bjnA           RDLLNVPSNYKVLFCHGGGFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAK----VTVD
1bj4A           ALQALDPQCWGVNVQPYSGSPANFAVYTALVEPIMGLDLPDGGHLTHGFMTDKKKISATSIFSMPYKVNP
1ejiA           LQAYLDPQCWGVNVQPYSGSPANFAVYTALHGRIGLDLPDGGHLTHGFTDKKKISATSIFFESPYKVYPE
2byjA           ITK--LFNYHKVLPMNTGVEAGETACKLARKAKIVFAAGNFWGRTLSAISSSTDPTSYDGGPFMPGFDII
3ecdC           QGSVLTNKYAEG---YDEVEALAIERVKRLFNAGHANVQPHSGAQANGALAKPGDTVLGMSLFNALQYGV
2btwB           ------------------------EKLLLTSRSEDFFPLSQFVTQVNQAYCGVASIIVLNSLGINAPETA
3ecdB           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           AAREAVNADPGGVVLGADRAVLLSLLAEASGYEVIVSRLDDEANWLRAAHRYGAKVKWAEVDIETGELPT
2btwA           ------------------------GEKLLLRSREDFFPLSQFVTQVNQAYCGVASIIVLNSLGINAPETA
1dfoA           AKEL-FGADYANVQPHSGSQANFAVYTALLGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYG---IDA
3dr4B           -----CGVKHAIACNNGTTALHLALVAMGIGPEVIVPSLTYIASANSVTYCGATPVLVDNDP-RTFNLDA
3bv0A           LLVDITPAGLDTVFFSDSSVSVEVAAKMALQYWRGRGLPDTFLAMSICDPHGGMHSLWTDVLAAQVFDYD
3dr4D           -----CGVKHAIACNNGTTALHLVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAA
3ecdD           QGSVLTNKYADE--VEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGV
1b9iA           HGA------AHALAVTNGTHALELALQVMPGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNL-DP
1btcA           ------------------------------------------------NVGDIVNIPIPQWVLDIGESNH
3ecdA           KYAEGADEVEALAIERVKRLFNAHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYG-----VSR
3e6gD           -----EGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVDL--TDP
3e6gB           ------------AFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVDLTDP
2bwpB           ---------------------TLSTLRVLFPGLIYSDSLNHASMIEGIKRNAGPKRIFRH-------NDV
3d19E           --------------------------FRCEDTQLIEEANQFYRLFEHEQIAHSYTNETDPE-------QI
1bybA           WRA--------------------YRSLFQLVQECGLTLQAIMSFHCGGNVGDIVNIPIPQWVLDIGESNH
1cj0A           ----------------------VYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSISMAYKVNPD
3dr4A           -----CGVKHAIACNNGTTHLALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVD-NDPRTFNLDA
3bh1A           ------------------------------VDGSIITGATSDLLGCSSSMLLNALKHLAGIDDAIHLLSP
1dy2A           ---------------------------------------------------LNTPVAGDIRADFQCFQQ-
3d19A           VTSVMFVENEIRFWSRIMKEHSFFLRLGFRDTQLIEEANQFYRLFEHEQIAHSYTNETDPEQ-------I
1eghA           ---------ARKHIALVAHDHCKQMLWVERHQPLLEQHVLYATGTTGNLISRATGMNVNAMLSGPMGGDQ
1awiA           ----------------------------------------------------------------------
3c01E           ---------------------------------------------------------------------P
3e6gA           --------------------------------------------------------------------DP
3c01F           ---------------------------------------------------------------------P


                         +         .         .         .         .         *         .:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
3ei6A           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3b46B           TRGEEWTIDFKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRI
3dydA           KQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEP
1bjwA           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE---H
2douB           KAVPEGVWR------EAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSP
5bj4A           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE--HF
2drrA           WANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEK--GYGHFFSNSYRVAANILDAEWF
3ei9A           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3ei6B           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
1d2fA           GKLEAVLAKPECKI-----MLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIP
5bj3A           ERVRRAIT------PRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE--HF
3eiaA           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3bmaD           QSGDQASQY-----AATRLLQQFPNVAMKDLVQKLASKEELSTADNEMRFNERQASFFGQFGYVNYDKHV
2douA           KAVPEGVWR------EAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSP
3ei7A           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3dydB           KQLEYLIDE------KTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEP
1b5pA           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE--HF
3b5oA           ---------TSKLLRTVLSLFDRQVDYVLGATYAIEATSIPELTLIVKLEWLHEGAIPKDLQYFFSKHLD
1b5oA           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
3ei8A           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
1ay4A           EGMKADLAAAKKG---DMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGLEEDAAGT
3ei7B           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3ei9B           RCPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
3e2yA           DWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVK
3e2fA           DWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVK
1djuB           DELKKYVTDKTRA------LIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYS
1bkgA           ERVRRAITP------RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE--HF
1djuA           DELKKYVTDKTRA------LIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYS
1d2fB           GKLEAVLAKPECKIM-----LLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQP-HI
3b46A           EWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRI
2cstA           QGLLDDM---EKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGSLDKDA
1bw0A           DEIRRLKDD------KTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNA
3cq4B           FRIDMDVALEEIRAKQPDIVFVT---TPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPS--AT
3eiaB           CTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSI
2egyB           LEEVLKRERPRFL------YLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGRLPSLF
3bwnD           -----------FDKKGPYIELVTSPNNPDGTIRET-----------VVNAKVIHDFAYYWPHYTP-----
2d5yA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFAREEDAEGL
7aatA           TGAMEDISKIPEKSI---ILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDA
2egyD           GPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGRLPSLF
1c7nA           QKLEKLSKDKNNKA-----LLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTV
3drdA           LRELAQLLEEHHEEIAALSIESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTG----K
1ay5B           EGMKADL---AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAA
3cbfA           GPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEAPSLF
3cq6A           VALEEIRAK------QPDIVFVTTPNNPTGDVTSL---DDVERIINVAPGIVIVDEAYAEFSPSPS---A
2d61A           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
3dpnA           ----------------------DQTNNPGGSVLYLYALLSMLTDRPLHRMILTQDEVVDALDWLTL---L
3d6kA           VVRELVKDPQVKG------WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTLSIVHNVI
1c8nA           SYDRNDVAPGS------RVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAWYSTIG
2aatA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
1aamA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
3bwnC           ------GDAWGFDKKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQDHDIMLFT----
1ax4A           KKLKENIAQHGADNI-VAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARD
3bwoC           -------DAWGFDKKGPYIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQDHDIM-------
3bwoE           -------DAWGFDKKGPYIELVTSPNNPDGTIRET----------------VVAKVIHDFAYYWPH---Y
3aatA           DALINS---LNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
1bqaA           DALINSLNEAQ---AGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
1aheA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFALEEDAEGL
1asfA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFARGLEEDAE
2d64A           DALINSLNEAQAGDV---VLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFALEEDAEGL
3bwoB           -------DAWGFDKKGPYIELVTSPNNPDGTIRET----------------VVAKVIHDFAYYWPH---Y
1ay4B           EGMKADL---AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAA
1akaA           TGAMEDI---SKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGRDAWAL
1cl1B           ADIVKHLQPNT------KIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKA-----
3cq5A           VALEEIRAK------QPDIVFVT---TPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSA--T
2egyC           GPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGRLPSLF
3dc1D           RDILSRWKPEPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKF--RV
1asbA           DALINS---LNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFAFAYQGFARGLEEDAE
1cl1A           ADIVKHLQPNT------KIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKA-----
2bwnD           ELIAADDPA------APKLIAFESVYSMDGDFGPIKEICDIA---EEFGALTYIDEVHAVGMYGPR---G
3bwoD           ------GDAWGFDKKGPYIELVTSPNNPDGTIRET----------------VVAKVIHDFAYYWPH---Y
3bv0B           EAQLAQHAG------ELAAVVVEPVVQGAGGMRDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGAL---
1ejjA           DRYWNEY---PHTTLKACGEAVGLPEGQMGNSEVG-HLNIGAGRIVYQSLTRINIAIREGEFDRNETFLM
1agxA           DAYQAFAKA------GVKAIIHAGTGNGSMANYL---VPEVRKLHDEQGLQIVRSSRVAQGFVL--RNAE
3bwoF           ------GDAWGFDKKGPYIELVTSPNNPDGTIRET----------------VVAKVIHDFAYYWPH---Y
1arhA           DALINSLNEAQ---AGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGFAREEDAEGL
1czcA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
3cq4A           FRIDMDVALEEIRAKQPDIVFVTTPNNPTG---DVTSLDDVERIINVAPGIVIVDEAYAEFSPSP--SAT
3d6kC           VVRELVKDPQVKG------WTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTDEFPIVHN
1ajsA           QGFLSDL---ENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDA
3d6kD           -----GVVRELVKDPQVKGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALHTLSDEIVHN
1bqdA           DALINSLNEAQAGDV---VLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
3bwnB           -----------------YIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTPIT---
1aiaA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEEGL
3cq5B           VALEEIRAK------QPDIVFVT---TPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSA--T
3bwoA           -----------------YIELVTSPNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQDHDIMLFT----
1dtyA           ARLMAAHRH------EIAAVIIEPIVQGAGGMYHPEWLKRIRKICDREGILLIADEIATGFGRTG----K
1bw0B           DEIRRLKDDKT------KLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKPNATFT
3bwnE           --------DAWFDKKGPYIELVTSPNNPDGTIRET-----------VVEAKVIHDFAYYWPHYTPIT---
3bwnA           -----------------YIELVTSPNNPDGTIRET----------VVDEAKVIHDFAYYWPHYTP-----
3bcaA           KAVEAKIQELGPEH-----ILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQ
1ariA           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
3dc1B           SRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKF--RV
3dzzA           ADLEEKLATPSVR-------VFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITP
3cogB           KLLEAAITPET------KLVWIETPTNPTQKVIDIEGCAHI--VHKHGDIILVVDNTFMSPYFQ------
2e7uA           EGLREVLKRRGE---EIAAIIFEPVVGNAGVLVPTEDFLKALHEAKAYGVLLIADEVMTGFRLAFG----
1b8gB           TALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSKDRNC
2bwnB           ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGP---RG
2d66A           DALINSL---NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
2dgmB           KRMIEACDE------NTIGVVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPFVAPDI
1b8gA           TALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFIS
2eh6A           AKLNDIDSVYKLLDEETAGIIIEVIQGEGGVNASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAY
1c7gA           NKLATLIKEKGAEN--IAYICLAVTVNLAGGQPVSMANMRAVEMASTYGIKIFYDATRCVENAYFINVSI
3cogD           KLLEAAIT------PETKLVWIETPTNPTQKVIDIEGCAHIV--HKHGDIILVVDNTFMSPYFQ------
3dc1A           SRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKF--RV
2bhxB           PDFSEFQLN-------------ENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQF
2dgmC           KRMIEACDENTIG------VVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPFVAPDI
1b4xA           DALINSL---NEAQAGDVVLFHGSCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYFARGLEEDAEGL
1eg5A           EELEKLVDEDTF-------LVSIAANNEVGTIQPV---EDVTRIVKKKNKETLVHVDAVQTIGKIP----
2aevA           --------ILNKIDKDTLVII--TGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRLLF---N
2dgmE           KRMIEACDE------NTIGVVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPFVAPDI
2ch2A           ETL-----ARAIELHQPKCLFLTHGDSSSGLLQPL---EGVGQICHQHDCLLIVDAVASLCGVPTGAQVL
1dgdA           DLIDRQSSGNLAAF-----IAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTG----T
3banA           VTLEEIKAIPGM-----QGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPN
1arsA           DALINS---LNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE
1eg5B           SRGVVKLEELEKLVDEDTFLVSIAANNEVGTIQP---VEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLE
2d3jA           ----------------------------------------------------------------------
2dkjA           LIDLEEVRRLALE------HRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG--LH
3dxvA           ILTLLTEKLAAVPAGSIGAAFIEPQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCF
1ajrA           QGFLSDLENAPEFSI---FVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASLEKDAWA
3caeA           LLIREQHPELD------IRIVFSSSRTKLYKGSPTSYG----EFCEKHGIKFADKLIPAEWIKEPKK-EV
3bwnF           -----------FDKKGPYIELVTSPNNPDGTIRETVVAK------------VIHDFAYYWPHYTP-----
2bwnA           ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPR---G
1ecxB           RGVVKLEELEKLVDEDTFLVSIMAANNEVGTI---QPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLE
3bcbA           KAVEAKIQELGPEHI-----LCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCM---H
3b8xB           ESLKEAVTDSTKAI------------LTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMG------ATF
2e7jA           ENFAQTIEET----KKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMP------
2bwoA           ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPR---G
3dxvB           ILTLLTEKLAAVPAGSIGAAFIEPIQSDGGLIPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCF
2bkwA           LITEKLSQN------SYGAVTVTHVDTSTAVLSDLKAISQAI-KQTSPETFFVVDAVCSIGCWGVDFALT
2bwpA           ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPR-GAG
2aeuA           GEILNKIDKDTLVII--------TGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRLLF---N
2dgkC           KRMIEACDE------NTIGVVPTFGVTYTGNYEFPQPLHDALDKDTGIDIDMHIDAASGGFLAPFVAPDI
1c4kA           RELAAKVDPERAKWKRPFRLAVIQLGTYDGTIY---NAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN
2c7tA           ---------QLIKSAITDKTKAIIPVHLFGSMA---NMDEINEIAQEHNLFVIEDCAQSHGSVWNNQRAG
2a7vA           DYNQ----LALTARLFRPRLIIAGTSAYAR----LIDYARMREVCDEVKAHLLADMAHISGLVAA----K
2dr1B           EDLDDAL----RKNPDVEAVTITYNETSTGVLNP---LPELAKVAKEHDKLVFVDAVSAMGGADIKFDKW
2c44C           EGLERGIEEVGPNN--VPYIVATITSNSAGGQPVSANLKAMYSIAKKYDIPVVMDSARFAENAYFIKWTI
2ch1A           ETL-----ARAIELHQPKCLFLTHGDSSSGLLQ---PLEGVGQICHQHDCLLIVDAVASLCGVPTGAQVL
2dr1A           EDLDDA----LRKNPDVEAVTITYNETSTGVLNPL---PELAKVAKEHDKLVFVDAVSAMGGADIKFDKW
2bwoD           ELIAADDPA------APKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGV
1ei7A           TALLGAFDTRN------RIIEVENQANPTTAETLDATRRVATVAIRSAINNLIVELIRGTGSYNRSS--F
3d6kB           VVRELVKDPQV------KGWTVPVFGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYLSDEFPIVHNVI
3bc8A           KAVEAKIQELGPEHI-----LCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCM---H
2e54A           FEFNNVEDLRRKMSEDVCAVFLEPIQGESGIVPATEFLEEARKLCDEYDALLVFDEVQCGMGRTG----K
2dgmA           RMIE-------ACDENTIGVVPTFGVTYTGNPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDI
3b8xA           ----------SLKEAVTDSTKAILTVNLLGNPNNF---DEINKIIGGRDIILLEDNCESMGATFNNKCAG
2c44B           EGLERGIEEVGPNN--VPYIVATITSNSAGGQPVSANLKAMYSIAKKYDIPVVMDSARFAENAIKQREAE
3dzzB           ADLEEKLATPSVR-------VFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITP
1d7uA           DLIDRQSSGNLAA-----FIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFAC
2c0rA           PKLQ-------------EIQLQDNAAYLHLTSNETIEGAQFKAFPDTGSVPLIGDMSSDILSRPFDLNQF
1e5eB           GEVKKHMKPNT------KIVYFETPANPTLKIIDMERVCKDA--HSQEGVLVIADNTFCSPMIT------
3bn1A           AKLEALITP------RTKAIMPVHLYGQICDMD------PILEVARRHNLLVIEDAAEAVGATYRGKKSG
3e77A           DPSTWNLNP------DASYVYYCANETVHG--------VEFDFIPDVKGAVLVCDMSSNFLSKPV-----
2bwnE           ELIAADDPA------APKLIAFESVYSMDGDFGPI---KEICDIAEEFGALTYIDEVHAVGMYGPR---G
1c0nA           DGTLQLETLPTLFDAATRLLAITHVSNVLGTENP---LAEMITLAHQHGAKVLVDGAQAVMHHPVD----
3bs8A           LAFQQFGE------DIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYN---C
2bieB           PDFS-------------EFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLK--VN
2bieA           DFSEFQLNE------NDAYLHITSNNTIYGTQ--------YQNFPEINHAPLIADMSSDILSRPLKVNQF
2bwoB           ELIAADDPA------APKLIAFESVYSMDGDFGPIKEICDI---AEEFGALTYIDEVHAVGMYGPRGAGV
1cs1A           QALRAALAE------KPKLVLVESPSNPLLRVVDI---AKICHLAREVGAVSVVDNTFLSPALQ------
2c81A           EADTYCIDPQLIKSAITDKTKAIIPVHLFGSM---ANMDEINEIAQEHNLFVIEDCAQSHGSVWNNQRAG
3dr4C           AKLEALITP------RTKAIMPVHLYGQICDMD------PILEVARRHNLLVIEDAAEAVGATYRGKKSG
3e9kA           GEETLRIEDIEKEGDSIAVILFSGVHFYTGQHFN---IPAITKAGQAKGCYVGFDLAHAVGNVELY----
1ecxA           EELEKLVDE------DTFLVSIMAANNEVGTIQPVEDVTRI---VKKKNKETLVHVDAVQTIGKIP----
1b9hA           EAVAAAVTPR------------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVG
3bcxB           SLIEAAVS------DKTKAIMIAHTLGNL------FDLAEVRRVADKYNLWLIEDCCDALGSTYDGKM--
3e77B           DPSTWNLNP------DASYVYYCANETVHGV--------EFDFIPDVKGAVLVCDMSSNFLSKPV-----
3e77C           DPSTWNLNP------DASYVYYCANETVHGVEF--------DFIPDVKGAVLVCDMSSNFLSKPVDVSKF
3bcxA           SLIEAAVS---------DKTKAIMIAHTLGNLFDL---AEVRRVADKYNLWLIEDCCDALGSTYDGKM--
2dgkA           KRMIEACDENTIGVV---PTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDI
2cb1A           EAVREALSAKT------RAVFVETVANPALLVPD---LEALATLAEEAGVALVVDNTFGAAGALC-----
1bjoA           VKPM----REWQLSDNAAYMHYCPNETIDGIA-------IDETPDFGADVVVAADFSSTILSRPI-----
3bn1D           AKLEALIT---------PRTKAIMPVHLYGQI---CDMDPILEVARRHNLLVIEDAAEAVGAGKKSGSLG
3bh1C           ESIEPIQTL------KTVHLGSSNPRLHTDEVLIA---LSVSAATDSNAQKALDQLKNLRGCDVHTTTIL
3bb8A           SLIEAAVS---------DKTKAIMIAHTLGNLF---DLAEVRRVADKYNLWLIEDCCDALGSTYDGKMAG
1e5eA           GEVKKHMKP------NTKIVYFETPANPTLKIIDMERVCK--DAHSQEGVLVIADNTFCSPMIT------
3bn1C           AKLEALITP------RTKAIMPVHLYGQI------CDMDPILEVARRHNLLVIEDAAERGKKSGSLGDCA
2cfbA           SRLFEQYPN------DIAGVILEPVVGNAGFIPPDGFLEGLRELTKQYGALLVFDEVMTGFRIAY-----
2c44A           EGLERGIEEVGPNN--VPYIVATITSNSAGGQPVSANLKAMYSIAKKYDIPVVMDSARFAENAIKQREAE
2cy8A           REVFANHGS------DIAAFIAEPVGSHFGVTVSDSFLREGAELARQYGALFILDEVISGFRVG-----N
2ctzA           EEFLALTDE------KTRAWWVESIGNPALNIP---DLEALAQAAREKGVALIVDNTFGMGGYL------
1dfoB           ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVD---WAKMREIADSIGAYLFVDMAHVAGLV-AAGVYP
3dr7B           AKL------EALITPRTKAIMPVHLYGQI------CDMDPILEVARRHNLLVIEDAAEAVGATYKSGSLG
1bjnA           GLRAVKPMREWQLSDNAAYMHYCPNETIDG-------IAIDETPDFGADVVVAADFSSTILSRPIDRYGV
1bj4A           DTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE---YARLRKIADENGAYLMADMAHISGLVGVVPSPF
1ejiA           TGYIN-YDQLEENASLFHPKLIIAGTSCYSRNL---DYARLRKIADDNGAYLADAHISGLVAAGPFEHCH
2byjA           PYNDLPALERALQDPNVAAFMVEPIQGEAGVVVDPGYLMGVRELCTRHQVLFIADEIQTGLARTG----R
3ecdC           SRDTMLIDYDEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVG---AKLMVDMAHIAGVIAA----G
2btwB           QYSPYRVFTQDNFFSNEKTKAVIAPEVVAKQG----TLDELGRLIASYGVKVKVNHASDTNIEDFRKQVA
3ecdB           --------QVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIAD---SVGAKLMVDMAHIAGVIAA----G
3bzsA           ----------------KSTVIVKDPTHIAICLYYKLGETQIIKLAELYDIPVIEDIPLARSLYKN----I
3caiA           WQWESLISK------STRLVAVNSASGTLGGV---TDLRAMTKLVHDVGALVVVDHSAAAPYRLL-----
2btwA           QYSPYRVFT-QDNFFSNEKTKAVIAPEVVARQGTLDELG---RLIASYGVKVKVNHASDTNIEDFRK--Q
1dfoA           TGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVD----WAKMREIADSIGAYLFVDMAHVAGLVAA----G
3dr4B           AKLEALIT---------PRTKAIMPVHLYGQI---CDMDPILEVARRHNLLVIEDAAEAVGATY----RG
3bv0A           PAYSAAFEAQLAQAGELAAVVVEPVVQGAGGMHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTG----A
3dr4D           KLEA----------LITPRTKAIMPVHLYGQI---CDMDPILEVARRHNLLVIEDAAEAVGATY----RG
3ecdD           SRDTMLIDQVEALAQQHKPSLIIAGFSAYPRKLD---FARFRAIADSVGAKLMVDMAHIAGVIAAG--RH
1b9iA           EAVAAAVTPR------------TKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVG
1btcA           DIFYTNRSGTRNKEYLTVGVDNPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVGLG--------
3ecdA           DTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKL---DFARFRAIADSVGAKLMVDMAHIAGVIAA----G
3e6gD           AAFKAAIRA------DTKMVWIETPTNPMLKLV---DIAAIAVIARKHGLLTVVDNTFA------SPMLQ
3e6gB           AAFKAAIRA------DTKMVWIETPTNPMLKLV---DIAAIAVIARKHGLLTVVDNTF------ASPMLQ
2bwpB           AHLRELIAADDPAAP--KLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAVA
3d19E           KRFNAEVQQAATN-----------IWGFKRKILG---LILTCKLPGQNNFPLLVDHTSREADYFRKRLIQ
1bybA           DIFYTNRSGTRNKEYLTVGVDNEPFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVGLGPAGELRYP
1cj0A           TGYIDYDRLEENARLFHPKLIIAGTSCYSRNLD----YGRLRKIADENGAYLMADMAH-ISGLVVAGVVP
3dr4A           AKLEALIT---------PRTKAIMPVHLYG---QICDMDPILEVARRHNLLVIEDAAEAVGATY----RG
3bh1A           ESIEPIQTL------KTVHLGSSNPRLHTDEVLIA---LSVSAATDSNAQKALDQLKN------------
1dy2A           -ARAAGLLS------TFRAFLSSHLQD----------LSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSG
3d19A           KRFNAEVQQA-----------ATNIWGFKRKILGLILTCKL---PGQNNFPLLVDHTSREADYFRKRLIQ
1eghA           QVGALISEGKIDVLI-----FFWDPLNAVPHDPD---VKALLRLATVWNIPVATNVATADFIIQ------
1awiA           ----------------------------------------MADGTCQDAAIVGYKDSPSVWAAVPG--KT
3c01E           THITIGI----YFKPELMPIPMI---SVYETNQR---ALAVRAYAEKVGVPVIVDIKLARSLFKTH----
3e6gA           AAFKAAIRA------DTKMVWIETPTNPMLKLV---DIAAIAVIARKHGLLTVVDNTFRPLSLGADLVVH
3c01F           THITIGI----YFKPELMPIPMI---SVYETNQ---RALAVRAYAEKVGVPVIVDIKLARSLFKTHRRDL


                         .         .         .         +         .         .         .:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
3ei6A           FEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLDGFPVAKDFNRIICTCFNGASNISQAGALACLTP
3b46B           ATLSPEIGQLTLTVGSAGSFAATGWRIGWVLSLN----AELLSYAAKAHTRICFASPSPLQEACANSIND
3dydA           LATLSTDVPILSCGGLAKRWLVPGWRLGWILIHD-RRDIFGNEIRDGLVKLSQRILGPTIVQGALKSILC
1bjwA           FSPGRVAPEHTLTVNGAAAFAMTGWRIGYAC-----GPKEVIKAMASVSSQSTTSPDTIAQWATLEALTN
2douB           LALPGAKERVVELFSLSKSYNLAGFRLGFALGS-----EEALARLERVKGVIDFNQYAGVLRMGVEALKT
5bj4A           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMAS-----VSRQSTTSPDTIAQWATLEALTN
2drrA           GGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEP-----FEEKSLHPVGLIATNAMGSLASVDGPYAKAN
3ei9A           FEIPGAEEVAMETASFSNYAGFTGVRLGWTVIPKKYSDGFPVAKDFNRIICTCFNGASNISQAGALACLT
3ei6B           FEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKYSDGFPVAKDFNRIICTCFNGASNISQAGALACLT
1d2fA           -WSNVARGDWALLTSGSKSFNIPALTGAYGIIE-----NSSSRDAYLSALKGRDGLSSPSVLALTAHIAA
5bj3A           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMAS-----VSRQSTTSPDTIAQWATLEALTN
3eiaA           FEIPGAEEVAMETASFSQYAGFTGVRLGWTVIPKKYSDGFPVAKDFNRIICTCFNGASNISQAGALACLT
3bmaD           AKYLKILPDQFSYQAIEDVVKADAEKNTSNNEM-------------------------------------
2douA           LALPGAKERVVELFSLSKSYNLAGFRLGFALGS-----EEALARLERVKGVIDFNQYAGVLRMGVEALKT
3ei7A           FEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLGFPVAKDFNRIICTCFNGASNISQAGALACLTP
3dydB           LATLSTDVPILSCGGLAKRWLVPGWRLGWI-LIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSIL
1b5pA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQST-----TSPDTIAQWATLEALTN
3b5oA           AGLRTSVAAYIQPEEFGEFAA--GFRAIDAQVW-------------------------------------
1b5oA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPK-----EVIKAMASVSSQSTTSPDTIAQWATLEALTN
3ei8A           FEIPGAEEVAMETASFSNYAGFTGVRLGWTVIPKKLLGFPVAKDFNRIICTCFNGASNISQAGALACLTP
1ay4A           RLIASRIPEVLIAASCSKNFGIYRERTGLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTT
3ei7B           FEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLGFPVAKDFNRIICTCFNGASNISQAGALACLTP
3ei9B           FEIPGAEEVAMETASFSNYAGFTGVRLGWTVIPKKLLYSDGFPVAKDFRIICTCFNGASNISQAGALACL
3e2yA           IATLPMWERTITIGSAGKTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAFWI
3e2fA           IATLPGMWERTITIGSAGTFSVTGWKLGWSIGPA-----HLIKHLQTVQQNSFYTCATPLQAALAEAFWI
1djuB           IALDGMFERTITVNGFSKTFAMTGWRLGFVAAPS-----WIIERMVKFQMYNATCPVTFIQYAAAKALKD
1bkgA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPK-----EVIKAMASVSSQSTTSPDTIAQWATLEALTN
1djuA           IASDGMFERTITVNGFSKTFAMTGWRLGFVAAPS-----WIIERMVKFQMYNATCPVTFIQYAAAKALKD
1d2fB           PWSNVARGDWALLTSGSKSFNIPALTGAYGIIEN-----SSSRDAYLSALKGRDGLSSPSVLALTAHIAA
3b46A           ATLSPEIGQLTLTVGSAGSFAATGWRIGWVLSLN----AELLSYAAKAHTRICFASPSPLQEACANSIND
2cstA           WAVVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNQRVLSQMEKIVRTTWSNPPSQGARIVATTLT
1bw0A           TFTSVADTVPRVILGGTANLVVPGWRLGWLLYVD-PHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALL
3cq4B           TLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPY-------HLSALSQAAAIVALRH
3eiaB           FEIPGAEEVAMETASFSQYAGFTGVRLWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACL
2egyB           ELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGAD-----LHTPMLNQMLVHELLKE
3bwnD           --ITRRQDHDIMLFTFSKITGHAGSRIGWALVKD----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
2d5yA           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSN
7aatA           WALRHFIIDVVLSQSYAKNMGLYGERAGAFTVICREEAKRVESQLKILIRPMYSNPPMNGARIASLILNT
2egyD           ELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGAD-----LHTPMLNQMLVHELLKE
1c7nA           FQDEQLADKTITFTAPSKTFNIAGMGMSNIIIKN----PDIRERFTKSRDATSGMPFTTLGYKACEICYK
3drdA           MFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYENLKTFFHGHSYTGQLGCAVALENLA
1ay5B           GTIASRIPEVLIAASCSKNFGIYRERTGLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTT
3cbfA           ELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQ-----AKQGADLHTPMLNQMLVHELLKE
3cq6A           TTLLEKYPTKLVVSRTMSAFDFAGGRLGYFVANP-----AFIDAVMLVRLPYHLSALSQAAAIVALRHSA
2d61A           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSN
3dpnA           ENVDTNVESRLALGDNMEGYTVDLQVAEYLKSFG-----RQVLNCWSKGDIELSTPIPLFGFEKIHPHPR
3d6kA           EFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVR-----GIGPNKLNQLAHAQFFGD
1c8nA           AAFAALTAFDQNQFCPCTVHIGSDGGPAVAVPPG------------------------------------
2aatA           GLRAFMHKELIVASSYSANFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATIL
1aamA           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIDANYSNPPAHGASVVATILSN
3bwnC           ----------------FSITGHAGSRIGWALVKDKE----VAKKMVEYIIVNSIGVSKESQVRTAKILNV
1ax4A           PKNATIKEVIFDMYKYADALTMSAKDPLIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMV
3bwoC           -------------LFTFSITGHAGSRIGWALVK----DKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
3bwoE           TPITRRQDHDIMLFTFSITG-HAGSRIGWALVKDKE----VAKKMVEYIIVNSIGVSKESQVRTAKILNV
3aatA           GLRAFMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1bqaA           GLRAFAMHKELIVASSYSNFGLYNERVGACTLVAAETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1aheA           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSN
1asfA           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
2d64A           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSN
3bwoB           TPITRRQDHDIMLFTFSITG-HAGSRIGWALVKDKE----VAKKMVEYIIVNSIGVSKESQVRTAKILNV
1ay4B           GTIASRIPEVLIAASCSKNFGIYRERTGLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTT
1akaA           RHFIEQGIDVVLSQSYAHNMGLYGERAGTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNT
1cl1B           ----LDFGIDVSIQAATYLVGHSDAMIGTAVCNARCWEQLR-----ENAYLMGQMVDADTAYITSRGLRT
3cq5A           TLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANP---------AFIDAVMLVRLPYHLLSQAAAIVALRH
2egyC           ELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGAD-----LHTPMLNQMLVHELLKE
3dc1D           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPK-----PLIERVILHIQVSTLHPSTFNQLMISQLLHE
1asbA           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1cl1A           ----LDFGIDVSIQAATYLVGHSDAMIGTAV-----CNARCWEQLRENAYLMGQMVDADTAYITSRGLRT
2bwnD           AGVAERDGLMHRIDIFNGTLAAYGVFGGYIAASA-----RMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
3bwoD           TPITRRQDHDIMLFTFSITG-HAGSRIGWALVKDKE----VAKKMVEYIIVNSIGVSKESQVRTAKILNV
3bv0B           -FAADHAGVSPDIMCVGKALTGGYLSLAATLCT-----ADVAHTISAGPTFMANPLACAVSVASVELLLG
1ejjA           NHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRL-----AAKEGVKRVYIHGFLDGRDVGPQTAPQYIKE
1agxA           QPDDKYGWIAAHDLNPQKARLLMALALTK-----------------------------------------
3bwoF           TPITRRQDHDIMLFTFSITG-HAGSRIGWALVKDKE----VAKKMVEYIIVNSIGVSKESQVRTAKILNV
1arhA           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1czcA           GLFAAMHKELIVASSYSKNFGLYNERVGTCTLVAAETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGN
3cq4A           TLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVR-------LPYHLSALSQAAAIVALRH
3d6kC           VIEFAQAAGNRFWFSSTSKITHAGSGVSFFASSK-----ENIEWYASHANVRGIGPNKLNQLAHAQFFGD
1ajsA           WAIRYFVFELFCAQSFSKNFGLYNERVGTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSD
3d6kD           VIEFAQAAGNRFWFSSTSKITHAGSGVSFFASSKENIEWYAS-----HANVRGIGPNKLNQLAHAQFFGD
1bqdA           GRAFAAMHKELIVASSYSNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
3bwnB           ----RRQDHDIMLFTFSKITGHAGSRIGWALVKD----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
1aiaA           RAFAAMHKELIVASSYSHNFGLYNERVGACTLVAAETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
3cq5B           TLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVAN-----PAFIDAVMLVRLPYHLSALSQAAAIVALRHSA
3bwoA           ----------------FSITGHAGSRIGWA----LVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
1dtyA           LFACEHAEIAPDILCLGKALTGGTMTLSATLTT-----REVAETISDGEAGCFMHGPTFMGNPACAAANA
1bw0B           SVADFETTVPRVILGGTANLVVPGWRLGWLLYVDPHG--NGPSFLEGLKRVGMLVCGPTVVQAALGEALL
3bwnE           ----RRQDHDIMLFTFSKITGHAGSRIGWALVKD----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
3bwnA           --ITRRQDHDIMLFTFSKITGHAGSRIGWALVKD----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
3bcaA           ---QGARVGRIDAFVQSLDNFMVPVGGAIIAGFN----EPFIQDISKMYPGRASASPSLDVLITLLSLGC
1ariA           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
3dc1B           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVIL-----HIQVSTLHPSTFNQLMISQLWGE
3dzzA           AFTDWDAKNWVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAAIAAYEEGHD
3cogB           --RPLALGADISMYSATKYMNGHSDVVMGLVSVN---CESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKT
2e7uA           -GATELLGLKPDLVTLGKILGGGLPAAAYAGRRE------IMEKVAPLGPVYQAGTLSGNPLAMAAGLEN
1b8gB           DENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSND----DMVVAAATKMSSFGLVSS--QTQHLLSAMLSD
2bwnB           AGVAERDGLMHRIDIFNGTLAAYGVFGGYIA-----ASARMVDAVRSYAPGFIFSTSLPPAIAAAQASIA
2d66A           GLFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSN
2dgmB           VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLG
1b8gA           VMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGQTQHLLSAMLSD
2eh6A           ----QHFNLKPDVIALAKGLG-GGVPIGAILAREEVAQSFTPGSHGS-----TFGGNPLACRAGTVVVDE
1c7gA           KDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLR
3cogD           --RPLALGADISMYSATKYMNGHSDVVMGLVSVN---CESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKT
3dc1A           PTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVIL-----HIQVSTLHPSTFNQLMISQLLHE
2bhxB           GMIYAGAQKNLGPSGVTVVIVKKDLLVEQVPTMLQYATHIKS-------DSLYNTPPTFSIYMLRNVLDW
2dgmC           VWDFRLPRVKSISASGHKFGLAPLGCGWIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYY
1b4xA           RAFAAMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1eg5A           -FSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNV------PGIVGAAR
2aevA           QPPALKLGADLVVTSTDL---MEGPRGGLLAGK-----KELVDKIYIEGTKFGLEAQPPLLAGKNFNLER
2dgmE           VWDFRLPRVKSISASGHKFGLAPLGCGWIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYY
2ch2A           GAPPGITPISISPKALDVIRNRRTKSKVFY-WDLLLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIA
1dgdA           MFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLFY----TTHVSDPLPAAVGLRVLDV
3banA           RDALIENAAGIPVVCYNFMPVFDWTRSDLHHPL-----PDGSTSLAFLKSDLAGVDPSKEEMKAIIENYR
1arsA           GLRAFMHKELIVASSYSKNFGLYNERVGTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN
1eg5B           -----KLEVDYASFSAHKFHGPKGVGITYIR---KGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEI
2d3jA           ----------------------------------------------------------------------
2dkjA           PNPLP--YAHVVTSTTHKTLRGPRGGLILSNDPE------------------------------------
3dxvA           EHEGFVPDILVLGKGLGGGLPLSAV-----------IAPAEILDCASAFAMQTLHGNPISAAAGLAVLET
1ajrA           IRYFVSEGFELFCAQSFSNFGLYNERNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSD
3caeA           PFDRLKRK--------------------------------------------------------------
3bwnF           --ITRRQDHDIMLFTFSKITGHAGSRIGWALVKD----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
2bwnA           AGVAERDGLMHRIDIFNGTLAAYGVFGGYI------AASARMVDAVRSYAPGFIFSTSLPPAIAAGAQAS
1ecxB           -----KLEVDYASFSAHKFHGPKGVGITY-IRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIA
3bcbA           LIQQGARVGRIDAFVQSLDNFMVPVGGAII----------------------------------------
3b8xB           NNKCAGTFGLMGTFSSFYSNHIATMEGGCI-----VTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSD
2e7jA           -VSLKEIGADFIVGSGHKSMAASGPIGVMGM--KEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMA
2bwoA           AGVAERDGLMHRIDIFNGTLAAYGVFGGYIAASA-----RMVDAVRSYAPGFIFSTSLPPAIAASIAFLK
3dxvB           EHEGFVPDILVLGKGLGGGLPL-SAVIA---------PAEILDCASAFAMQTLHGNPISAAAGLAVLETI
2bkwA           ASQAIGAPAGLSISLCSSRFDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKGAYFATPNSLDVALKEIL
2bwpA           VAERDGHRIDIFNGTLAKAYGVFGGYIAASARMV----DAVRSYAPGFIFSTSLPPAIAAGAQASIAFLK
2aeuA           QPPALKLGADLVVTSTDK--LMEGPRGGLLAGK-----KELVDKIYIEGTKFGLEAQPPLLAGKNFNLER
2dgkC           VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEPQELVFNVDYLGGQIGTFAINFSRPAGQIAQYYEFL
1c4kA           SSPLLIDPGIIVVQSVHKQQAGFSQTSQIHKKDSHGQLRYCDHKHFNNSFNLFMSTSPFYPMYALDVNAA
2c7tA           ------TIGDIGAFSCQQGKVLTAGEGGII-----VTKNPRLFELIQQLRADSRVYCDDSSELMHGDMQL
2a7vA           VIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGV------------------------------------
2dr1B           GLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKESTPPMPQVFGINVALRI
2c44C           EQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAV
2ch1A           GAPPGITPISISPKALDVIRNRRTKSKVFYWDL-----LLLGNYWGCYDEPKRYHHTVASNLIFALREAL
2dr1A           GLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKESTPPMPQVFGINVALRI
2bwoD           AERDGMHRIDIFNGTLAKAYGVFGGYIAAS--------ARMVDAVRSYAPGFIFSTSLPPAIAAAQASIA
1ei7A           ESSSGLVWTSGPAT--------------------------------------------------------
3d6kB           EFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSK-----ENIEWYASHANVRGIGPNKLNQLAHAQFFGD
3bc8A           LIQQGARVGRIDAFVQSLDNFMVPVGGAII-----AGFNEPFIQDISKMYPGRASASPSLDVLITLLSLG
2e54A           LFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNER-----ANVLEPGDHGTTFGGNPLACRAGVTVIKLTK
2dgmA           VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEPQELVFNVDYLGGQIGTFAINFSRPAGQIAQYYEFL
3b8xA           ------TFGLMGTFSSFYSNHIATMEGGCI-----VTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSD
2c44B           YKDWTIEQITMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGL
3dzzB           AFTDWDAKNWVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAAIAAYEEGHD
1d7uA           Q----RDGVTPDILTLSKT-LGAGLPLAAIVTSAAIEERAHELGYLFY---TTHVSDPLPAAVGLRVLDV
2c0rA           GLVYAGAKNLGPSGVTVVIVREDLVAESPKHLPT-----MLRYDTYVKNNSLYNTPPSFGIYMVNEVLKW
1e5eB           --NPVDFGVDVVVHSATKYINGHTDVVAGLICGKADL-LQQIRMVGIKDITGSVISPHDAWLITRGLSTL
3bn1A           SLGDCATFSFIITTGEGGMITTNDDDLAAKMRLLRGQGMDPNR---RYWFPIVGFNYRMTNIQAAIGLAQ
3e77A           ------DVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKSLYNTPPCFSIYVMGLVLE
2bwnE           AGVAERDGLMHRIDIFNGTLAAYGVFGGYI------AASARMVDAVRSYAPGFIFSTSLPPAIAAGAQAS
1c0nA           ---VQALDCDFYVFSGHKLYGPTGIGILY-----------------------------------------
3bs8A           AQGYFGVTPDLTC--LGKV-IGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQLT
2bieB           QFGMIYAGAQKNLGPSGVTVVIVKKDLLVEQVPTM---LQYATHIKSDSLYNTPPTFSIYMLRNVLDWIK
2bieA           GMIYAGALGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDS-------LYNTPPTFSIYMLRNVLDW
2bwoB           AERDLMHRIDIFNGTLAKAYGVFGGYIAASARMV----DAVRSYAPGFIFSTSLPPAIAAGAQASIAFLK
1cs1A           --NPLALGADLVLHSCTYLNGHSDVVAGVVIAKD----PDVVTELAWWANNIGVTGGAFDSYLLLRGLRT
2c81A           ------TIGDIGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQMHGDMQLVKKGDIQGSNYCLSEFQSAIL
3dr4C           SLGDCATFSFIITTGITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVG-------FNYRMTNIQAAIGLAQ
3e9kA           ---LHDWGVDFACWCSYKYLNAGAGGIAGA----------------------------------------
1ecxA           -FSLEKLEVDYASFSAHKFHGPKGVGITYIR-----KGVPIRPLIHGGGQERGLRSGTQNVPGIVGA---
1b9hA           ------ELDSIATFSFQNGKLMTAGEGGAVVFPDGE-----TEKYETAFLRHSCGRPRDDRRYFHKIAGS
3bcxB           ----AGTFGDIGTVSFYPAHHITMGEGGAVF-----TQSAELKSIIESFRDWGRDCLGSLPFGYDHKYTY
3e77B           ------DVSKFGVIFAGAQKNVGSAGVTVVIVRDD-----------------------------------
3e77C           GVIFAGAQKNVGSAGVTVVIVRDGFALRECPSVLEYKVQAGNSS--------LYNTPPCFSIYVMGLVLE
3bcxA           ----AGTFGDIGTVSFYPAHHITMGEGGAVFTQSAELKSIILPFGYDHKYTYSHLGYNLKITDMQAACGL
2dgkA           VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEF--L
2cb1A           --RPLAWGAHVVVESLTWASGHGSVLGGQFLQPWEALRARCFPERVRTLGLSLCGMALSPFNAYLLFQGL
1bjoA           ------DVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSIMFNTPPTFAWYLSGLVFK
3bn1D           DCATFSFFGNIITTGEGGMITTDLAAKMRL------LRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQ
3bh1C           G---------------------------------------------------------------------
3bb8A           ------TFGDIGTVSFYPAKHITMGEGGAVFTQSAE----------------------------------
1e5eA           --NPVDFGVDVVVHSATKYINGHTDVVAGLICGKADL-LQQIRMVGIKDITGSVISPHDAWLITRGLSTL
3bn1C           T---FSFFGNIITTG-EGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLE
2cfbA           -GGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRA-----EIMKMVAPAGPTLSGNPLAMTAGIKTLEILS
2c44A           YKDWTIEQITRETYKYADMLAMMVPMGGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAV
2cy8A           HGMQALLDVQPDLTCLAKASA-GGLPGGILGGREDVMGVLSRGSFTG----------NPITAAAAIAAID
2ctzA           -LRPLAWGAALVTHSLTK----------------------------------------------------
1dfoB           NPVPHA--HVVTTTTHKTLAGPRGGLILAKGGS-----EELYKKLNSAVFPGGQGGPLMHVIAGKAVALK
3dr7B           DCATFSFFGNIITTGEGGMINDDDLAAKMRLLRG-----QGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQ
1bjnA           IYAGAQNIGPAGLTIVIVREDLLGKANIACP----SILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKA
1bj4A           EHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDP-----ATGKEILYNLESLINSAVFPGLQGGPHNHAIA
1ejiA           TTTTHKTLRGCRAGIFYRKGVRSVDPKTGKETYYELESLINSAVF----PGLQGGPHNHAIAGVAVALKQ
2byjA           WLAVDYENVRPDIVLLGKALSGGLYPVS------------------------------------------
3ecdC           RHANPVEHAHVVTSTTHK--TLRGPRGGFV-----LTNDEEIAKKINSAVGPLMHVIAGKAVAFGEALTD
2btwB           ENL-KQDGNFVIVNYLRKE--IGQERGGHI-----SPLAAYNEQTDRFLIDVSRYKYPPVWVKTTDLW--
3ecdB           RHANPVEHAHVVTSTTHKTLRGPRGGFVL-------TNDEEIAKKINSAVFPGPLMHVIAGKAVAFGEAL
3bzsA           HKGQYITEDFFEPVAQLIRIAI------------------------------------------------
3caiA           ----------------------------------------------------------------------
2btwA           VAENLKDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIDVSRYKYPPVWVKTTDLWKANTVDSVS
1dfoA           VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPG----GQGGPLMHVIAGKAVALK
3dr4B           KKSGSLGDCATFSFFGNAIITTGLAAKM-RLLRGQGMDPNRRYWFPI-----VGFNYRMTNIQAAIGLAQ
3bv0A           LFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGPTFM---------ANPLACAVSVASVE
3dr4D           KKSGSLGDCATFSFFGNAIITTGGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGMTNIQAAIGLAQ
3ecdD           ANPVE--HAHVVTSTTHK--TLRGPRGGFVLTND----EEIAKKINSAVGPLMHVIAGKAVAFGEALTDD
1b9iA           ------ELDSIATFSFQNGKLMTAGEGGAVVFPDGE-----TEKYETAFLRHSCGRPRDDRRYFHKIAGS
1btcA           ----------------------------------------------------------------------
3ecdA           RHANPVEHAHVVTSTTHK--TLRGPRGGFV----------------------------------------
3e6gD           RPLSLGAD--LVVHSATKYLNGHSDMVG------------------------------------------
3e6gB           RPLSLGAD--LVVHSATKYLNGHSDMVG------------------------------------------
2bwpB           ERDGLMHRIDIFNGTLAKAYGVFGGYIA------------------------------------------
3d19E           LNEGLDALPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSNDFDE----------------
1bybA           SYPQSQGWEFPRIGEFQCY--DKYLKADFKAAVARAGHPEWE----------------------------
1cj0A           SPFEHC---HVVTTTTHKTLMIFYRRGVRSVDILYNLESLINS---AVFPGLQGGPHNHAIAGVAVALKQ
3dr4A           KKSGSLGDCATFSFFGNAIITTGTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQL
3bh1A           ----------------------------------------------------------------------
1dy2A           DGGQFNTHIPIYSFDGRDVMTDPSW---------------------------------------------
3d19A           LNEGLDALPDAIIKENVFFLRIMADHA-------------------------------------------
1eghA           -SPHFNDAVDILIPDYQRYLA-------------------------------------------------
1awiA           FVNITPAEVGVLVGKDRSSFYVNGLTLG------------------------------------------
3c01E           ----------------------------------------------------------------------
3e6gA           S---------------------------------------------------------------------
3c01F           VSLEE-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
3ei6A           EGL--EAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSS-----------WDVFAEIL
3b46B           A-LKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLSKVKIPEDYPYPEEILNKGKRISHWLI
3dydA           RTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFEND-----VEFTERLV
1bjwA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAP----------DEVRAAERL
2douB           PKVVRGYARVYRERA-----LGMAEALKGVLSLLPPRATMYLWGRL----------PEGVDDLEFGLRLV
5bj4A           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDT------------------------
2drrA           VDLFWNTPVRTGNRRYY-------DNCLYLFAMLALSGNFKIW---------------------------
3ei9A           PEGLEAMHKVIGFYKEN-TNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSS-----------WDVFAEIL
3ei6B           PEGLEAMHKVIGFYKEN-TNIIIDTFTSLGYDVYGGKNAPYVWVHF---------PNQSS--WDVFAEIL
1d2fA           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLN-------IDDNALQKALI
5bj3A           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPD----------EVRAAERL
3eiaA           PEGLEAMHKVIGFYKEN-TNIIIDTFTSLGYDVYGGKNAPYVWVHFP---------NQSS--WDVFAEIL
3bmaD           ----------------------------------------------------------------------
2douA           PKEVVGYARVYRERA-----LGMAEALKGVLSLLPPRATMYLWGRLP----------EGVDDLEFGLRLV
3ei7A           EGL--EAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSS-----------WDVFAEIL
3dydB           CRTPGEFYHNTLSFLKNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFEND-----VEFTERLV
1b5pA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDT---------SPIAPDEVRAAERLL
3b5oA           ----------------------------------------------------------------------
1b5oA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDT---------SPIAPDEVRAAERLL
3ei8A           EGL--EAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSS-----------WDVFAEIL
1ay4A           PELRADWMAELEA--VRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGAT------PEQVKRIK
3ei7B           EGL--EAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSS-----------WDVFAEIL
3ei9B           TPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFP---------NQSS--WDVFAEIL
3e2yA           DIKRECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEYDYKFVKWMT
3e2fA           DIKRMCYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNDEPYDYKFVKWMT
1djuB           ERSWKAVEEMRKEYDRR-RKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGL---------TSKKFSELML
1bkgA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDT---------SPIAPDEVRAAERLL
1djuA           E-RSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGL---------TSKKFSELML
1d2fB           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELQIPQSTYLAWLDLRPLNI---------DDNALQKALI
3b46A           A-LKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLSKVKIPEDYPYPEEILNKGKRISHWLI
2cstA           SPQLFAWKDNVKTMA--DRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLN------PKQVEYMI
1bw0A           NTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTD-----VEFFEKLL
3cq4B           SADTLGTVEKLSVER----VRVAARLEELGYAVVPSESNFVFFGDQHAAWQAFLDRG-------------
3eiaB           TPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHF----------PNQSSWDVFAEILE
2egyB           GFS--ERLERVRRVY-------------------------------------------------------
3bwnD           LKETCKSESESENFFKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
2d5yA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGL---------------TKEQVLRLR
7aatA           PEEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQERLTKEFSIYMTK-------
2egyD           GFS--ERLERVRRVY-------------------------------------------------------
1c7nA           ECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLIEGTYLQWIDFRALKM---------DHKAMEEFMI
3drdA           LFESENIVEQVAEKSKKLHFLLQDLHALPHVGDIRQLGFMCGAEL-------VRSKETKEPYPADRRIGY
1ay5B           PELRADWMAELEAVRSG--MLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGAT------PEQVKRIK
3cbfA           GFS--ERLERVRRVY-------------------------------------------------------
3cq6A           --DTLGTVEKLSVER----VRVAARLEELGYAVVPSESNFVFFGDFSDQHAA--------------WQAF
2d61A           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
3dpnA           VQYSKPICVLINEQDFACADFFPVVLKDNDRALIVGTRTAGAGGFVFNVQFPNRTGCSLTGSLAVREHGA
3d6kA           VAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTAS-----------RVVELAK
1c8nA           ----------------------------------------------------------------------
2aatA           SNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLT------KEQVLRLR
1aamA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
3bwnC           LSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
1ax4A           QGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAV--INALY
3bwoC           LKESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
3bwoE           LKETCKSESESENFFKYGREMMKNRWEKLREVV-KESDAFTLPEAFCNYFGKSLESYPAFAWLGTKEEEL
3aatA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQLRLREEFGV-----------
1bqaA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL--------------TKEQVLRLRE
1aheA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1asfA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQLRLREEFGVYAVA-------
2d64A           DA--------------------------------------------------------------------
3bwoB           LKETCKSESESEN-FFKYGREMMKNRWEKLREVVKESDAFTLPEAFCNYFGKSLESYPATKEETDLVSEL
1ay4B           PELRADWMAELEAVR--SGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGAT------PEQVKRIK
1akaA           PE--------------------------------------------------------------------
1cl1B           LGVRLR-QHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLNNEELANF
3cq5A           SADTLGTVEKLSVER----VRVAARLEELGYAVVPSESNFVFFGDFSDQHAA--------------WQAF
2egyC           GFS--ERLERVRRVY-------------------------------------------------------
3dc1D           WGE-------------------------------------------------------------------
1asbA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1cl1A           LGVRLRQHHESSL-KVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLNNEELDNF
2bwnD           AFLKTAEGQKLRD-AQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGD--------PVHT--KAVSDMLL
3bwoD           LKETCKSESESEN-FFKYGREMMKNRWEKLREVVKESDAFTLPEAFCNYFGKSLESYPATKEETDLVSEL
3bv0B           Q----DWRTRITELAAGLTAGLDTARALPAVTDVRVCGAIGVIECDRPVDLA-----------VATPAAL
1ejjA           LQEKI-----------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
3bwoF           LKETCKSESESENFFKYGREMMKNRWEKLREV-VKESDAFTLPEAFCNYFGKSLESYPATKEETDLVSEL
1arhA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1czcA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGL---------------TKEQVLRLR
3cq4A           SADTLGTVEKLSVER----VRVAARLEELGYAVVPSESNFVFFGDFSDQHAA--------------WQAF
3d6kC           VAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTAS-----------RVVELAK
1ajsA           PELFHEWTGNVKTMADR--------ILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLI
3d6kD           VAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTAS-----------RVVELAK
1bqdA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
3bwnB           LKETCKSFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
1aiaA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
3cq5B           --DTLGTVEKLSVER----VRVAARLEELGYAVVPSESNFVFFGDFSDQHAA--------------WQAF
3bwoA           LSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
1dtyA           SLAILESGDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMA--------ALQKFFV
1bw0B           NTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTD-----VEFFEKLL
3bwnE           LKETCNFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
3bwnA           LKETCKSFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
3bcaA           SKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQ---------LGSML
1ariA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
3dc1B           EGFMAHVDRVIDFYS------NQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVK--ELIEEKA
3dzzA           WLRELKQVLRDNFAYAREFLAK------------EVPEVKVLDSNASYLAWVDISALGNA--EDFCKYLR
3cogB           LHVRMEKHFKNG--MAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEKNL
2e7uA           PGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRTDT-ELFKRFFHGLL
1b8gB           KKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFE----AEMELWKKIV
2bwnB           FLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHT------------KAVSDMLL
2d66A           DA--------------------------------------------------------------------
2dgmB           REGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYT------LYDLSERL
1b8gA           KKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFE----AEMELWKKIV
2eh6A           VEKLLPHVREVGN---------------------------------------------------------
1c7gA           EAMQYEYIEHRVKQV----RYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQDQFPAQ--SLAASIY
3cogD           LHVRMEKHFKNGM---------------------------------------------------------
3dc1A           WGE-------------------------------------------------------------------
2bhxB           IKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQF-------LAKA
2dgmC           EFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERL
1b4xA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1eg5A           AEIAVEELSEAAKHEKL-RSKLVSGLNLGAHIITPLEISLPNTLSVSFPNIR----------GSTLQNLL
2aevA           IRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKRV-----YKDDTINIKKLIEIGFNLL
2dgmE           EFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERL
2ch2A           EEGLENQIKRRIECA----------QILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAM
1dgdA           VQR-DGLVARANVM--------------------------------------------------------
3banA           Q---------------------------------------------------------------------
1arsA           DAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---------------TKEQVLRLR
1eg5B           AVEELSEAAKHEKL--------------------------------------------------------
2d3jA           ----------------------------------------------------------------------
2dkjA           ----------------------------------------------------------------------
3dxvA           IDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREPAR----AETAKLIYRA
1ajrA           PELFHEWTGNVKTMADR--ILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLN------PKQVEYLI
3caeA           ----------------------------------------------------------------------
3bwnF           LKESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSEL
2bwnA           IAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVH----------TKAVSDMLL
1ecxB           VEELSEAAKHMEKL--------------------------------------------------------
3bcbA           ----------------------------------------------------------------------
3b8xB           DQFEESFKFVLPGYN-------------------------------------------------------
2e7jA           SFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGD------NPHNHDLMFFHAEVLYEISKKAKGGRFF
2bwoA           TAEGQKLRDAQQMHA---KVLKMRLKALGMPIIDHGSHIVPVVIGDPVHT------------KAVSDMLL
3dxvB           -DRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREPARA----ETAKLIYRA
2bkwA           EEGLHKRWDLHRESDWF----KDSLVNGLQLTSVSRYPSNSAHGLTAV----------YVADPPDVIAFL
2bwpA           TAEGQKLRDAQQMHAKVLKM-------------RLKALGMPIIDHGSHIVPVVIGDPVHT--KAVSDMLL
2aeuA           IRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKRVYK-----DDTINIKKLIEIGFNLL
2dgkC           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIP-AVCFKLKDGEDPGYT--LYDLSERL
1c4kA           MQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGK----KWEDGDTEDMA-----NNIDYWR
2c7tA           VKKGDIQGSNYCLSE-------------------------------------------------------
2a7vA           ----------------------------------------------------------------------
2dr1B           IEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDE---------VYEAM
2c44C           GLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQFPA----QALACELY
2ch1A           AQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWW------KVSQYAM
2dr1A           IEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDEV---------YEAM
2bwoD           FLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHT------------KAVSDMLL
1ei7A           ----------------------------------------------------------------------
3d6kB           VAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTAS-----------RVVELAK
3bc8A           CSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPIS---LAMTLKTIDGHHDKAV--TQLGSML
2e54A           EGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREE--------------VSNREVATKCF
2dgmA           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIP-AVCFKLKDGEDPGYT--LYDLSERL
3b8xA           DQFEESFKFVLPGY--------------------------------------------------------
2c44B           YDG--MNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQF----PAQALACELY
3dzzB           WLRELKQVLRDNFAYAR----EFLAKEVPEVKVLDSNASYLAWVDI--------SALGNA--EDFCKYLR
1d7uA           VQR-DGLVARANVM--------------------------------------------------------
2c0rA           IEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCVDVDSRSDMNITFRLASEELEKEF-------VKAS
1e5eB           NIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEGAKKLLDNL
3bn1A           LERVDEHLAARERVV----GWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTT--RDQVIKDL
3e77A           WIKNNGGAAAMEKLS-------------------------------------------------------
2bwnE           IAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGD--------PVHT--KAVSDMLL
1c0nA           ----------------------------------------------------------------------
3bs8A           PDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINYETAKASDL--------KLFA
2bieB           DLGGAE--AIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQF-------LAKA
2bieA           IKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQF-------LAKA
2bwoB           TAEGQKLRDAQQMHAKVLKM-------------RLKALGMPIIDHGSHIVPVVIGDPVHT--KAVSDMLL
1cs1A           LVPRME----------------------------------------------------------------
2c81A           LDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSRQTYYGYVFRFDPVKFGGLNADQFCEILR
3dr4C           LERVDEHLAARERV----VGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTT--RDQVIKDL
3e9kA           ----------------------------------------------------------------------
1ecxA           ----------------------------------------------------------------------
1b9hA           NMRLNEFSASVLRA--------------------------------------------------------
3bcxB           ----------------------------------------------------------------------
3e77B           ----------------------------------------------------------------------
3e77C           WIKNNGGAAAMEKLS-------------------------------------------------------
3bcxA           -AQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENS-DPSWFGFPITLKEDSGVS--RIDLVKFL
2dgkA           RLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPG---YTLYDLSERL
2cb1A           ETVALRVARMSETARFLAERLQGHPKVKALRYPGLPEDPAHRNARK-YLASGGPILTLDLGDLERASRFL
1bjoA           WLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRSRMNVPFQLADSALDKLF-------LEES
3bn1D           LERVDEHLAARERV--------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3bb8A           ----------------------------------------------------------------------
1e5eA           NIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEGAKKLLDNL
3bn1C           --RVDEHLAARERV----VGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTT--RDQVIKDL
2cfbA           RPGSYE----------------------------------------------------------------
2c44A           GLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQFP----AQALACELY
2cy8A           TILEDDVCAKINDLGQFARE--------------AMNHLFARKGLNW-LAYGRFSGFHLMPGLPPNTTDT
2ctzA           ----------------------------------------------------------------------
1dfoB           EAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDL---------VDKNLTGKEADAALG
3dr7B           LERVDEHLAARERV--------------------------------------------------------
1bjnA           NGGVAEMDKINQQKA----ELLYGVIDNSDFYRNDVAKRNRSRMNVPFQLADSALDKLF-------LEES
1bj4A           GVAVALKQAMTLEF--------------------------------------------------------
1ejiA           ATT--EFKIYQLQVL-------------------------------------------------------
2byjA           ----------------------------------------------------------------------
3ecdC           DFK-----TYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDL---RPKGLKGAQVEQALERAGITC
2btwB           ----------------------------------------------------------------------
3ecdB           TDDFKTYIDRVLAN--------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           ----------------------------------------------------------------------
2btwA           ----------------------------------------------------------------------
1dfoA           EAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVD--------KNLT--GKEADAAL
3dr4B           LERVDEHLAARERV--------------------------------------------------------
3bv0A           LLLGQDWRTRITEL--------------------------------------------------------
3dr4D           LERVDEHLAARERVVGWYEQKLA----------RLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQV
3ecdD           FKTYIDRVLANAQ---------------------------------------------------------
1b9iA           NMRLNEFSASVLRA--------------------------------------------------------
1btcA           ----------------------------------------------------------------------
3ecdA           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
2bwpB           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
1bybA           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------------------
3dr4A           ERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGLSTTRDQV-------IKDL
3bh1A           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1awiA           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISEVLDEVRQEQ
3ei6A           EKTHVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
3b46B           NELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDAY---------------LENAVERLKLLKDY-----
3dydA           AEQSVHCLPATCFEYP---NFIRVV----ITVPEVM---------------MLEACSRIQEFCEQHYH--
1bjwA           LEAGVAVVPGTDFA---AFGHVRLS---------------------------------------------
2douB           ER-GVALAPGRGFG--------------------------------------------------------
5bj4A           ----------------------------------------------------------------------
2drrA           ----------------------------------------------------------------------
3ei9A           EKTHVVTTPGSGFGPGGEGF-VRVS----AFGHREN---------------ILEACRRFKQLYKHHHH--
3ei6B           EKTHVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
1d2fA           EQEKVAIMPGYTYGEEGR-GFVRLN----AGCPRSK---------------LEKGVAGLINAIRAVR---
5bj3A           LEAGVAVVPGTDFA---AFGHVRLS---------------------------------------------
3eiaA           EKTHVVTTPGSGFGPGGEGF-VRVS----AFGHREN---------------ILEACRRFKQLYKHHHH--
3bmaD           ----------------------------------------------------------------------
2douA           ER-GVALAPGRGFGPGGKGVRIALVRP-------------------------------------------
3ei7A           EKTHVVTTPGSGFGPGGEGF-VRVS----AFGHREN---------------ILEACRRFKQLYKHHHH--
3dydB           AEQSVHCLPATCFEYP---NFIRVV----ITVPEVM---------------MLEACSRIQEFCEQHYH--
1b5pA           EA-GVAVVPGTDFA---AFGHVRLS---------------------------------------------
3b5oA           ----------------------------------------------------------------------
1b5oA           E-AGVAVVPGTDFA---AFGHVRLS---------------------------------------------
3ei8A           EKTHVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
1ay4A           EEFGIYMVGDSRINIAGL----------------------------------------------------
3ei7B           EKTHVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
3ei9B           EKTHVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
3e2yA           KHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDST----------------------------------
3e2fA           KHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDST----------------------------------
1djuB           KEARVAVVPGSAFGKAGE-GYVRIS----YATAYEK---------------LEEAMERMERVLKERKL--
1bkgA           E-AGVAVVPGTDFA---AFGHVRLS---------------------------------------------
1djuA           KEARVAVVPGSAFGKAGE-GYVRIS----YATAYEK---------------LEEAMERMERVLKERK---
1d2fB           EQEKVAIMPGYTYGEEGRG-FVRLN----AGCPRSK---------------LEKGVAGLINAIRAVR---
3b46A           NELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDAY---------------LENAVERLKLLKDY-----
2cstA           KEKHIYLMASGRINMCGL----------------------------------------------------
1bw0A           EEENVQVLPGTIFHAP---GFTRLT----TTRPVEV---------------YREAVERIKAFCQRHA---
3cq4B           ----------------------------------------------------------------------
3eiaB           KT-HVVTTPGSGFGPGGEGVRVSAFGH-------------------------------------------
2egyB           ----------------------------------------------------------------------
3bwnD           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
2d5yA           EEFGVYAVASGRLNVAGM----------------------------------------------------
7aatA           ----------------------------------------------------------------------
2egyD           ----------------------------------------------------------------------
1c7nA           HKAQIFFDEGYIFGDGGI-GFERIN----LAAPSSV---------------IQESLERLNKALKDLK---
3drdA           KVSLKMRELGMLTRPLGDVIAFLPP----LASTAEE---------------LSEMVAIMKQAIHEVTS--
1ay5B           EEFGIYMVGDSRINIAGL----------------------------------------------------
3cbfA           ----------------------------------------------------------------------
3cq6A           LDRGVLIRDVGIAG----HLRTTIGVP-------------------------------------------
2d61A           EEFGVYAVASGRVNVAGM----------------------------------------------------
3dpnA           FIENIGVEPHIDLPFTANDRYKGYSEYL------------------------------------------
3d6kA           EAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA-----------------ELEVADGFATCVLAALE--
1c8nA           ----------------------------------------------------------------------
2aatA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1aamA           EEFGVYAVASGRVNVAGM----------------------------------------------------
3bwnC           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
1ax4A           LESGVRAVEIGSFLLGRDPATGEQKHADMEFMRLTIARRVYTNDH------MDYIADALIGLKEKFATLK
3bwoC           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
3bwoE           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
3aatA           ----------------------------------------------------------------------
1bqaA           EF-GVYAVASGRVNVAGM----------------------------------------------------
1aheA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1asfA           ----------------------------------------------------------------------
2d64A           ----------------------------------------------------------------------
3bwoB           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
1ay4B           EEFGIYMVGDSRINIAGL----------------------------------------------------
1akaA           ----------------------------------------------------------------------
1cl1B           SLFSMAYSWGGYESLILAQPEHIAAIRPQGEIDFSGTLIRL----HIGLEDVDDLIADLDAGFARI----
3cq5A           LDRGVLIRDVGIAG----HLRTTIGV--------------------------------------------
2egyC           ----------------------------------------------------------------------
3dc1D           ----------------------------------------------------------------------
1asbA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1cl1A           SLFSMAYSWGGYESLILAQPEHIAAIRPQGEIDFSGTLIRL----HIGLEDVDDLIADLDAGFARI----
2bwnD           SDYGVYVQPINFPTVPRGTERLRFTPSP------------------------------------------
3bwoD           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
3bv0B           DRGVWLRPFR-------NLVYAMPP----YICTPAE---------------ITQITSAMVEVARLVG---
1ejjA           ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
3bwoF           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
1arhA           EEFGVYAVASGAVNVAGM----------------------------------------------------
1czcA           EEFGVYAVASGRLNVAGM----------------------------------------------------
3cq4A           LDRGVLIRDVGIAG----HLRTTIGV--------------------------------------------
3d6kC           EAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA-----------------ELEVADGFATCVLAALE--
1ajsA           NQKHIYLLPSGRINMCGL-TTKNLDYV-------------------------------------------
3d6kD           EAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA-----------------ELEVADGFATCVLAALE--
1bqdA           EEFGVYAVASGRVNVAGM----------------------------------------------------
3bwnB           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
1aiaA           EEFGVYAVASGRVNVAGM----------------------------------------------------
3cq5B           LDRGVLIRDVGIAG----HLRTTIGV--------------------------------------------
3bwoA           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
1dtyA           EQGVWIRPF-------GKLIYLMPP----YIILPQQ---------------LQRLTAAVNRAVQDETFF-
1bw0B           EEENVQVLPGTIFHAP---GFTRLT----TTRPVEV---------------YREAVERIKAFCQRHA---
3bwnE           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
3bwnA           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
3bcaA           FTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVRKEQ
1ariA           EEFGVYAVASGRVNVAGM----------------------------------------------------
3dc1B           VKMGVLMLPGNAFYVDSSAPSPYLRASFSS-ASPEQ---------------MDVAFQVLAQLIKES----
3dzzA           EKTGLIISAGNGYRGNHEFVRINLACP-------------------------------------------
3cogB           KLFTLAESLGGFESPSDTLIRLSVG---------------------------------------------
2e7uA           DR-GIYWPPS-----NFEAAFLSVAHR-------------------------------------------
1b8gB           YEVHLNISPGSSCHCTPGWFRVCFAN--------------------------------------------
2bwnB           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
2d66A           ----------------------------------------------------------------------
2dgmB           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLSD--
1b8gA           YEVHLNISPGSSCHCTPGWFRVCFAN--------------------------------------------
2eh6A           ----------------------------------------------------------------------
1c7gA           METGVRSMERGIVSAGRSKETGENHRPKLETVRLTIPRRVYTYAH------MDVVADGIIKLYQHKEDIR
3cogD           ----------------------------------------------------------------------
3dc1A           ----------------------------------------------------------------------
2bhxB           KEQGFVGLNGHRSVG-----GCRASIYNAVPIDACIA---------------------------------
2dgmC           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLSDH-
1b4xA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1eg5A           SGYGIYVSTHVLDAGVDRRIAIRISLCKYNTEEEVDY---------------------------------
2aevA           KNYGIITITVAGMPGASKSLRIDLTS--------------------------------------------
2dgmE           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLSD--
2ch2A           NNFSLEVQGGLGPTFGKAWRVGIMG----ECSTVQK---------------IQFYLYGFKESLKATHPD-
1dgdA           ----------------------------------------------------------------------
3banA           ----------------------------------------------------------------------
1arsA           EEFGVYAVASGRVNVAGM----------------------------------------------------
1eg5B           ----------------------------------------------------------------------
2d3jA           ----------------------------------------------------------------------
2dkjA           ----------------------------------------------------------------------
3dxvA           YQLGLVVYYVGMNGN---VLEFTPP----LTITETD---------------IHKALDLLDRAFSELSAVS
1ajrA           NQKHIYLLPSGRINMCGL----------------------------------------------------
3caeA           ----------------------------------------------------------------------
3bwnF           RRHKVMSRAGERCGSDKKHVRVSMLSR-------------------------------------------
2bwnA           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
1ecxB           ----------------------------------------------------------------------
3bcbA           ----------------------------------------------------------------------
3b8xB           ----------------------------------------------------------------------
2e7jA           LYRELKSRKIHGIKPGLTRYF-------------------------------------------------
2bwoA           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
3dxvB           YQLGLVVYYVGMNGN---VLEFTPP----LTITETD---------------IHKALDLLDRAFSELSAVS
2bkwA           KSHGVVIAGGIHKDIGPKYIRIGHGVTACNKNLPYKN---------------------------------
2bwpA           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
2aeuA           KNYGIITITVAGMPGASKSLRIDLTS--------------------------------------------
2dgkC           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLSDHP
1c4kA           FEKGAKWHAYEGYGDNQYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDH---------------
2c7tA           ----------------------------------------------------------------------
2a7vA           ----------------------------------------------------------------------
2dr1B           RKRGFELAKGYGSVKEKT---FRIGHMGYMKFED-----------------IQEMLDNLREVINELKKQK
2c44C           KVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTH------MDFIIEAFKHVKENASNIK
2ch1A           NNFSLEVQGGLGPTFGKAWRVGIMG----ECSTVQK---------------IQFYLYGFKESLKATHPD-
2dr1A           RKRGFELAKGYGSVKEKT---FRIGHMGYMKFED-----------------IQEMLDNLREVINELKKQK
2bwoD           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
1ei7A           ----------------------------------------------------------------------
3d6kB           EAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA-----------------ELEVADGFATCVLAALE--
3bc8A           FTRQVSGARAVPLG-NVQTVSGHTFRGFMSHADNYPCAYGMKMQD------VDLFIKRLDKCLNIVRKEQ
2e54A           EN-KLLVVPAGNNT-----IRFLPP----LTVEYGE---------------IDLAVETLKKVLQGI----
2dgmA           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDF-----------------AELLLEDYKASLKYLSDHP
3b8xA           ----------------------------------------------------------------------
2c44B           KVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTH------MDFIIEAFKHVKENASNIK
3dzzB           EKTGLIISAGNGYRGNHEFVRINLACP-------------------------------------------
1d7uA           ----------------------------------------------------------------------
2c0rA           EQEGFVGLKGHRSVG-----GLRASIYNAVPYESCEA---------------------------------
1e5eB           KLITLAVSLGGCESLIQHP-ASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL----
3bn1A           DALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNL----PTHAGLTEADIDRVIAALDQV----
3e77A           ----------------------------------------------------------------------
2bwnE           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
1c0nA           ----------------------------------------------------------------------
3bs8A           SYYKGMANEGVFLPPSQ---FEGLFLSTAHTDED-----------------IENTIQAAEKVFAEISR--
2bieB           KEQGFVGLNGHRSVG-----GCRASIYNAVPIDACIA---------------------------------
2bieA           KEQGFVGLNGHRSVG-----GCRASIYNAVPIDACIA---------------------------------
2bwoB           SDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDG---------------------------------
1cs1A           ----------------------------------------------------------------------
2c81A           EKLNMGTFYLHPPY-LPVHKNPLFCPWTKNRYLKSVRKTHYPVSERASGQSIVIHHAIEPSHLSLLVDA-
3dr4C           DALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNL----PTHAGLTEADIDRVIAALDQV----
3e9kA           ----------------------------------------------------------------------
1ecxA           ----------------------------------------------------------------------
1b9hA           ----------------------------------------------------------------------
3bcxB           ----------------------------------------------------------------------
3e77B           ----------------------------------------------------------------------
3e77C           ----------------------------------------------------------------------
3bcxA           DEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMNQTFWIGIYPGLTHDHLDYVVSKFEEFFGL-
2dgkA           RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELL-----------------LEDYKASLKYLSDHP
2cb1A           GAIRLLKAANLGDARTLL-VHPWTTTHSRLKEEA------------------------------------
1bjoA           FAAGLHALKGHRVVG-----GMRASIYNAMPLEGVKA---------------------------------
3bn1D           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3bb8A           ----------------------------------------------------------------------
1e5eA           KLITLAVSLGGCESLIQHP-ASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDALLR--
3bn1C           DALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVD----GLNLPTHAGLTEADIDRVIAALDQV----
2cfbA           ----------------------------------------------------------------------
2c44A           KVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTH------MDFIIEAFKHVKENASNIK
2cy8A           GSITRAEVARPDVKMIAAMRMALILEGVDIGGRGSVFLSAQHERE-----HVEHLVTTFDRVLDRLADEN
2ctzA           ----------------------------------------------------------------------
1dfoB           RAVNKNSVPNDPKSPVTSGIRVGTPAITRRGFEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARY
3dr7B           ----------------------------------------------------------------------
1bjnA           FAAGLHALKGHRVV---GGMRASIY---------------------------------------------
1bj4A           ----------------------------------------------------------------------
1ejiA           ----------------------------------------------------------------------
2byjA           ----------------------------------------------------------------------
3ecdC           NKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVRTNPEGDHATEQRVRREIFALCERF
2btwB           ----------------------------------------------------------------------
3ecdB           ----------------------------------------------------------------------
3bzsA           ----------------------------------------------------------------------
3caiA           ----------------------------------------------------------------------
2btwA           ----------------------------------------------------------------------
1dfoA           GRANITVNKNSVPNDPKSPFGIRVGTPAITRRGFKEAE-------------AKELAGWMCDVLDSINDE-
3dr4B           ----------------------------------------------------------------------
3bv0A           ----------------------------------------------------------------------
3dr4D           IKDLDALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNLPTHAGLTEADIDRVIAALDQV----
3ecdD           ----------------------------------------------------------------------
1b9iA           ----------------------------------------------------------------------
1btcA           ----------------------------------------------------------------------
3ecdA           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
2bwpB           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
1bybA           ----------------------------------------------------------------------
1cj0A           ----------------------------------------------------------------------
3dr4A           DALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVD----GLNLPTHAGLTEADIDRVIAALDQV----
3bh1A           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1awiA           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PAVAVPAMAx
3ei6A           ----------
3b46B           ----------
3dydA           ----------
1bjwA           ----------
2douB           ----------
5bj4A           ----------
2drrA           ----------
3ei9A           ----------
3ei6B           ----------
1d2fA           ----------
5bj3A           ----------
3eiaA           ----------
3bmaD           ----------
2douA           ----------
3ei7A           ----------
3dydB           ----------
1b5pA           ----------
3b5oA           ----------
1b5oA           ----------
3ei8A           ----------
1ay4A           ----------
3ei7B           ----------
3ei9B           ----------
3e2yA           ----------
3e2fA           ----------
1djuB           ----------
1bkgA           ----------
1djuA           ----------
1d2fB           ----------
3b46A           ----------
2cstA           ----------
1bw0A           ----------
3cq4B           ----------
3eiaB           ----------
2egyB           ----------
3bwnD           ----------
2d5yA           ----------
7aatA           ----------
2egyD           ----------
1c7nA           ----------
3drdA           ----------
1ay5B           ----------
3cbfA           ----------
3cq6A           ----------
2d61A           ----------
3dpnA           ----------
3d6kA           ----------
1c8nA           ----------
2aatA           ----------
1aamA           ----------
3bwnC           ----------
1ax4A           GLEFEYEP--
3bwoC           ----------
3bwoE           ----------
3aatA           ----------
1bqaA           ----------
1aheA           ----------
1asfA           ----------
2d64A           ----------
3bwoB           ----------
1ay4B           ----------
1akaA           ----------
1cl1B           ----------
3cq5A           ----------
2egyC           ----------
3dc1D           ----------
1asbA           ----------
1cl1A           ----------
2bwnD           ----------
3bwoD           ----------
3bv0B           ----------
1ejjA           ----------
1agxA           ----------
3bwoF           ----------
1arhA           ----------
1czcA           ----------
3cq4A           ----------
3d6kC           ----------
1ajsA           ----------
3d6kD           ----------
1bqdA           ----------
3bwnB           ----------
1aiaA           ----------
3cq5B           ----------
3bwoA           ----------
1dtyA           ----------
1bw0B           ----------
3bwnE           ----------
3bwnA           ----------
3bcaA           ----------
1ariA           ----------
3dc1B           ----------
3dzzA           ----------
3cogB           ----------
2e7uA           ----------
1b8gB           ----------
2bwnB           ----------
2d66A           ----------
2dgmB           ----------
1b8gA           ----------
2eh6A           ----------
1c7gA           GLTFVYE---
3cogD           ----------
3dc1A           ----------
2bhxB           ----------
2dgmC           ----------
1b4xA           ----------
1eg5A           ----------
2aevA           ----------
2dgmE           ----------
2ch2A           ----------
1dgdA           ----------
3banA           ----------
1arsA           ----------
1eg5B           ----------
2d3jA           ----------
2dkjA           ----------
3dxvA           NEEI------
1ajrA           ----------
3caeA           ----------
3bwnF           ----------
2bwnA           ----------
1ecxB           ----------
3bcbA           ----------
3b8xB           ----------
2e7jA           ----------
2bwoA           ----------
3dxvB           NEEI------
2bkwA           ----------
2bwpA           ----------
2aeuA           ----------
2dgkC           KL--------
1c4kA           ----------
2c7tA           ----------
2a7vA           ----------
2dr1B           ----------
2c44C           GLTFTYEP--
2ch1A           ----------
2dr1A           ----------
2bwoD           ----------
1ei7A           ----------
3d6kB           ----------
3bc8A           ----------
2e54A           ----------
2dgmA           K---------
3b8xA           ----------
2c44B           GLTFT-----
3dzzB           ----------
1d7uA           ----------
2c0rA           ----------
1e5eB           ----------
3bn1A           ----------
3e77A           ----------
2bwnE           ----------
1c0nA           ----------
3bs8A           ----------
2bieB           ----------
2bieA           ----------
2bwoB           ----------
1cs1A           ----------
2c81A           ----------
3dr4C           ----------
3e9kA           ----------
1ecxA           ----------
1b9hA           ----------
3bcxB           ----------
3e77B           ----------
3e77C           ----------
3bcxA           ----------
2dgkA           KL--------
2cb1A           ----------
1bjoA           ----------
3bn1D           ----------
3bh1C           ----------
3bb8A           ----------
1e5eA           ----------
3bn1C           ----------
2cfbA           ----------
2c44A           GLTFTYEPK-
2cy8A           LLSWQG----
2ctzA           ----------
1dfoB           P---------
3dr7B           ----------
1bjnA           ----------
1bj4A           ----------
1ejiA           ----------
2byjA           ----------
3ecdC           P---------
2btwB           ----------
3ecdB           ----------
3bzsA           ----------
3caiA           ----------
2btwA           ----------
1dfoA           ----------
3dr4B           ----------
3bv0A           ----------
3dr4D           ----------
3ecdD           ----------
1b9iA           ----------
1btcA           ----------
3ecdA           ----------
3e6gD           ----------
3e6gB           ----------
2bwpB           ----------
3d19E           ----------
1bybA           ----------
1cj0A           ----------
3dr4A           ----------
3bh1A           ----------
1dy2A           ----------
3d19A           ----------
1eghA           ----------
1awiA           ----------
3c01E           ----------
3e6gA           ----------
3c01F           ----------