[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56580.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a9xA.bssp"
#ERROR : Can't open dsspfile "2c00B.bssp"
#ERROR : Can't open dsspfile "1ce8A.bssp"
#ERROR : Can't open dsspfile "1b6sB.bssp"
#ERROR : Can't open dsspfile "1dv1A.bssp"
#ERROR : Can't open dsspfile "1dv2A.bssp"
#ERROR : Can't open dsspfile "1c30A.bssp"
#ERROR : Can't open dsspfile "1dv2B.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"
#ERROR : Can't open dsspfile "1bxrA.bssp"
#ERROR : Can't open dsspfile "2c00A.bssp"
#ERROR : Can't open dsspfile "1b6sC.bssp"
#ERROR : Can't open dsspfile "2dzdA.bssp"
#ERROR : Can't open dsspfile "3d2oA.bssp"
#ERROR : Can't open dsspfile "3e5nA.bssp"
#ERROR : Can't open dsspfile "1bncA.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"
#ERROR : Can't open dsspfile "3d2oB.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "3bg5C.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "1dv1B.bssp"
#ERROR : Can't open dsspfile "3bg5B.bssp"
#ERROR : Can't open dsspfile "1bncB.bssp"
#ERROR : Can't open dsspfile "3bg5D.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "3d8nA.bssp"
#ERROR : Can't open dsspfile "3d8tA.bssp"
#ERROR : Can't open dsspfile "3df7A.bssp"
#ERROR : Can't open dsspfile "1ehiA.bssp"
#ERROR : Can't open dsspfile "1b6rA.bssp"
#ERROR : Can't open dsspfile "1ehiB.bssp"
#ERROR : Can't open dsspfile "3d8rA.bssp"
#ERROR : Can't open dsspfile "1auvB.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "3d8tB.bssp"
#ERROR : Can't open dsspfile "1auvA.bssp"
#ERROR : Can't open dsspfile "1e4eB.bssp"
#ERROR : Can't open dsspfile "1cqjB.bssp"
#ERROR : Can't open dsspfile "1dosA.bssp"
#ERROR : Can't open dsspfile "2dxcF.bssp"
#ERROR : Can't open dsspfile "3e7dB.bssp"
#ERROR : Can't open dsspfile "2bv8B.bssp"
#ERROR : Can't open dsspfile "3czqD.bssp"
#ERROR : Can't open dsspfile "3e7dA.bssp"
#ERROR : Can't open dsspfile "1e4eA.bssp"
#ERROR : Can't open dsspfile "3czqA.bssp"
#ERROR : Can't open dsspfile "2dd4F.bssp"
#ERROR : Can't open dsspfile "3czqC.bssp"
#ERROR : Can't open dsspfile "3e7dC.bssp"
#ERROR : Can't open dsspfile "2cqyA.bssp"
#ERROR : Can't open dsspfile "3dluD.bssp"
#ERROR : Can't open dsspfile "3czqB.bssp"
#ERROR : Can't open dsspfile "3cwcB.bssp"
#ERROR : Can't open dsspfile "1b57A.bssp"
#ERROR : Can't open dsspfile "2abrB.bssp"
#ERROR : Can't open dsspfile "2afrA.bssp"
#ERROR : Can't open dsspfile "2afvA.bssp"
#ERROR : Can't open dsspfile "2cyzA.bssp"

## Summary of PDB Search
:385
    1e-30  13%  1a9xA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    2e-30  13%  2c00B  [x.x.x] BIOTIN CARBOXYLASE
    3e-30  14%  1ce8A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    9e-30  26%  1b6sB  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-29  14%  1dv1A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    7e-28  16%  1dv2A  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    5e-27  13%  1c30A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    5e-27  16%  1dv2B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-26  16%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
    4e-26  13%  1bxrA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    6e-26  12%  2c00A  [x.x.x] BIOTIN CARBOXYLASE
    6e-26  28%  1b6sC  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    8e-26  17%  2dzdA  [x.x.x] PYRUVATE CARBOXYLASE
    2e-25   7%  3d2oA  [x.x.x] UPF0343 PROTEIN NGO0387
    3e-25  14%  3e5nA  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    5e-25  14%  1bncA  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    8e-25  15%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
    2e-24   7%  3d2oB  [x.x.x] UPF0343 PROTEIN NGO0387
    2e-24  21%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    8e-23  16%  3bg5C  [x.x.x] PYRUVATE CARBOXYLASE
    1e-22  18%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    2e-22  26%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-22  15%  1dv1B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    9e-22   9%  3bg5B  [x.x.x] PYRUVATE CARBOXYLASE
    2e-21  14%  1bncB  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    1e-20   9%  3bg5D  [x.x.x] PYRUVATE CARBOXYLASE
    3e-20  19%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    5e-20  10%  3d8nA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    1e-19  11%  3d8tA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    2e-19  11%  3df7A  [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN
    4e-19  12%  1ehiA  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    5e-19  28%  1b6rA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    5e-19  12%  1ehiB  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    2e-18  11%  3d8rA  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    3e-18  10%  1auvB  [c.30.1 - d.142.1] SYNAPSIN IA
    9e-18  19%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-16  13%  3d8tB  [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
    5e-15  11%  1auvA  [c.30.1 - d.142.1] SYNAPSIN IA
    2e-14  14%  1e4eB  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    3e-14  11%  1cqjB  [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN
    5e-13   9%  1dosA  [c.1.10] ALDOLASE CLASS II
    7e-13  11%  2dxcF  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT GAMMA
    2e-12  17%  3e7dB  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    2e-12   9%  2bv8B  [x.x.x] C-PHYCOCYANIN BETA SUBUNIT
    2e-12  22%  3czqD  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-12  13%  3e7dA  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    9e-11  13%  1e4eA  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    1e-10  22%  3czqA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-09   9%  2dd4F  [x.x.x] THIOCYANATE HYDROLASE GAMMA SUBUNIT
    7e-09  23%  3czqC  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    9e-09  13%  3e7dC  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    2e-08  22%  2cqyA  [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,
    9e-08  17%  3dluD  [x.x.x] SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN
    1e-07  23%  3czqB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-07  10%  3cwcB  [x.x.x] PUTATIVE GLYCERATE KINASE 2
    7e-07  16%  1b57A  [c.1.10] PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
    1e-06   9%  2abrB  [x.x.x] ARGININE DEIMINASE
    1e-06  16%  2afrA  [x.x.x] COBALAMIN BIOSYNTHESIS PRECORRIN ISOMERASE
    1e-05  15%  2afvA  [x.x.x] COBALAMIN BIOSYNTHESIS PRECORRIN ISOMERASE
    2e-04  16%  2cyzA  [x.x.x] NITRILE HYDRATASE SUBUNIT ALPHA
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxVVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHXXXXXXXXXXXAFAKDS
1a9xA           ----------ILILGAGPIVAQACKALREEGYRVINVNSNPTIMTDPEMADATYIEPIHWEVVRKIIEKE
2c00B           ----------VLIANRGEIALRILRACKELGIKTVAVHSTA-DRELMHLSLADESVCIGPAPATQSYLQI
1ce8A           ----------ILILGAGPIVAQACKALREEGYRVINVNSNPTIMTDPEMADATYIEPIHWEVVRKIIEKE
1b6sB           ----------VCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVI-----------------
1dv1A           ----------IVIANRGEIALRILRACKELGIKTVAVHSSAADETVCIGPAPSVKSYLNIPAIISAAEIT
1dv2A           ----------IVIANRGEIALRILRACKELGIKTVAVHSSAADETVCIGPAPSVKSYLNIPAIISAAEIT
1c30A           ----------ILILGAGPIVAQACKALREEGYRVILVNSNPTIMTDPEMADATYIEPIHWEVVRKIIEKE
1dv2B           ----------IVIANRGEIALRILRACKELGIKTVAVHSSAADETVCIGPAPSVKSYLNIPAIISAAEIT
2dzdB           ----------VLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYHRKADEAYLVGEGKKPIEAYLDIE
1bxrA           ----------ILILGAGPIVAQACKALREEGYRVILVNSNPTIMTDPEMADATYIEPIHWEVVRKIIEKE
2c00A           ----------VLIANRGEIALRILRACKELGIKTVAVHSTADRELMHLSLADESVCIGPAPATQSYLQIP
1b6sC           ----------VCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVI-----------------
2dzdA           ----------VLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYHREGKKPIEAYLDIEGIIEIAKAH
3d2oA           -------------------------PINQVGIKDLRFPITLKTAEGTQSTVARLTMTVYLPAEQHMSRFV
3e5nA           ----------VGLIFGGKSARNILDALDPQRFEPVLIGIDKQGQWHVNDPDSFLLHADDPARIALHRSGR
1bncA           ----------IVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSAAEIT
3bg5A           ----------LLVANRGEIAIRIFRAAAELDIDKSSLHRYKADESYLVGSDLGPAESYLNIERIIDVADA
3d2oB           -----------------------NLPINQVGIKDLRFPITLKTAEGTQSTVARLTMTVYLPAEQKMSRFV
2czgA           ----------ILLLGSGELGKEIAIEAQRLGVEVVAVANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPD
3bg5C           ----------LLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLVGSDLGPAESYLNIERIIDVAKDA
2dwcB           ----------ILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVERE
1b6sA           ----------VCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVI-----------------
1dv1B           ----------IVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYAEIT
3bg5B           ----------------------------------------------------------------------
1bncB           ----------IVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIP
3bg5D           ----------------------------------------------------------------------
2czgB           ----------ILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVERE
3d8nA           ----------------------------------------------------------------------
3d8tA           ----------------------------------------------------------------------
3df7A           -------------TCGERIEDSTAVEGLAFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSDSEKYLEKS
1ehiA           ----------------------------------------------------------------ALKSAG
1b6rA           ----------VCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVI-----------------
1ehiB           ----------------------------------------------------------------------
3d8rA           ----------------------------------------------------------------------
1auvB           ---------VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVANGGFSVDEVLRNGVKVVRSL
2dwcA           ----------ILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVERE
3d8tB           ----------------------------------------------------------------------
1auvA           ---------LLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHASVDEVLRNGVKVVRSLKPD
1e4eB           ----------VAILFGGCSAIEIAANINKEKYEPLYIGITKSGVWKMCSPDKKMHGLLVKKNHEYEINHV
1cqjB           ----------------------------------------------------------------------
1dosA           ----------------------------------------------------------------------
2dxcF           ----------------------------------------------------------------------
3e7dB           ----------------------------------------------------------------ELAKKI
2bv8B           ----------------------------------------------------------------------
3czqD           ----------------------------------------------------------------------
3e7dA           -------------------AGKAGRNALLAGAPILCDARMVAEGITRSRLPADNRVIYTLSDPSVPELAK
1e4eA           ----------VAILFGGCSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPNCYSAVLSPDKKMHGLLVK
3czqA           ----------------------------------------------------------------------
2dd4F           ----------------------------------------------------------------------
3czqC           ----------------------------------------------------------------------
3e7dC           -------------------AGKAGRNALLAGAPILCDAR-MVAEGITRSRLPADNRVIYTLSDPSVPELA
2cqyA           ----------------------------------------------------------------------
3dluD           ----------------------------------------------------------------------
3czqB           ----------------------------------------------------------------------
3cwcB           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
2afrA           ----------------------------------------------------------------------
2afvA           ----------------------------------------------------------------------
2cyzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
1a9xA           RPQTALNCALELERQGVLEEFGVTMGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD
2c00B           PHPGYGFLAENADFAEQIERSGFTFVPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPDEETALAIARE
1ce8A           RPQTALNCALELERQGVLEEFGVTMIATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD
1b6sB           ----TAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1dv1A           GHPGYGFLSENANFAEQVERSGFIIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNRAIAKR
1dv2A           GAVAIHPGYGFLSENANVERSGFIFGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPDMDKNRAIAKR
1c30A           RPQTALNCALELERQGVLEEFGVTIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD
1dv2B           GAVAIHPGYGFLSEAEQVERSGFIFGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPDMDKNRAIAKR
2dzdB           GIIEIAKAHDVDAIHPGYGFLSIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPGLEDVVAFAEA
1bxrA           RPQTALNCALELERQGVLEEFGVTMGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD
2c00A           AIIAAAEVTGATAIHPGYGFLAEFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLEETALAIARE
1b6sC           ----TAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
2dzdA           DVDAIHPGYGFQFAKRCREEGIIFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDVDGLEDVVAFAEA
3d2oA           ALMEQHTEVLDFAQLHRLTAEMVALDSRAGKISVSFPFFRKKTAP-VSGIRSLLDYDVSLTGEMKDGAYG
3e5nA           DVVFPIVHGTLGEDGSLQMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDAHADVDTLIAQ
1bncA           GAVAIHPGYGFLSENANFAEQFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLMDKNRAIAKR
3bg5A           IHPGYGFLSENEQFARRCAEEGIKIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGKSYELAKEFAEE
3d2oB           ALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYDVSLTGEM--KDGA
2czgA           AIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEK
3bg5C           IHPGYGFLSENEQFARRCAEEGIFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDIKSYELAKEFAEE
2dwcB           KPDAIIPEIEAINLDALFEFEKFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEK
1b6sA           ----TAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1dv1B           GAVAIHPGYGFLSENANFAEGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLMDKNRAIAKR
3bg5B           -VAIYSNEDKSSLHRYKADESYLV-GSDLGPAESYLNIERIIDVAKQANVDAIHPGYLSENEQFARRCAE
1bncB           AIISAAEITGAVAIHPGYGFLSEFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNRAIAKR
3bg5D           ------YSNEDKSSLHRYKADESYLGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFENEQFARRCAE
2czgB           KIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEK
3d8nA           -AYAGLRRKEE--FKALAEKLGFPLLFPVQATEKVPVPEYRDQVRELAGVDLFLATTGVGVRDLLEAGKA
3d8tA           -AYAGLRRKEE--FKALAEKLGFPLLFPVQATEKVPVPEYRDQVRELAQGVATTGVGVRDLLEAGKALGL
3df7A           DAFLIIAPELLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRG-EVQVPQT-----------SLRP
1ehiA           DFVVHGNLGEDGTLQGLFKLLDKPYGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDNNWSWDKIVAE
1b6rA           ---TAEIERWPETALTRQLARHPA-FVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1ehiB           -PVVHGNLGEDGTLQGLFKLLDKPVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPNWSWDKIVAE
3d8rA           -AYAGLRRKEE--FKALAEKLGFPLLFPVQATEKVPVPEYRDQVRELAQGVATTGVGVRDLLEAGKALGL
1auvB           KPDFVLIRQHAFSARNGDYRAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLITFYPNHKELSS
2dwcA           KPDAIIPEIEAINLDAFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEK
3d8tB           -AYAGLRRKEE--FKALAEKLGFPLLFPVQATEKVPVRDQVRELAQGVDLFLTTGVGVRDLLEAGKALGL
1auvA           FVLIRQHAFSARNGDIGLQYAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLINQTPNHKELSS
1e4eB           DVAFSALHGKSGEDGSIQGLGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR--PVAAT
1cqjB           ----------------------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASK
1dosA           --------------------------DFVKPGVITGDDVQKVFQVAKENNFALPAVGTDSINAVLETAAK
2dxcF           ----------------------------------------------------------------------
3e7dB           GNTRSAAALDLWLPHIEGS--IVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANS
2bv8B           ----------------AQADARGE-FLSNTQLDA--LANMIAEGNKRLDIVNRINSNASAIVSNSARALF
3czqD           ----GREQLKRFHDRRHDPLKIWKLSPDIAALSKWDDYTGKRDRLKETHTEHGPWAVIRGNDKRRS----
3e7dA           KIGNTRSAAALDLWLPHIEGSIVAIGNAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANS
1e4eA           KNHEYEINHVDVAFSALFELSGIPFVCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR--PVAAT
3czqA           ----GREQLKRFHDRRHDPLKIWKLSPDIAALSKWDDYTGKRDRLKETHTEHGPWAVIRGNDKR-----R
2dd4F           ----------------------------------------------------------------------
3czqC           -----REQLKRFHDRRHDPLKIWKLSPDIAALSKWDDYTGKRDRLKETHTEHGPWAVIRGNDKRRSR---
3e7dC           KKIGNTRSAAALDLWLPHIEGSIVAINAPTALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANS
2cqyA           ------------------------------------DKIESKLLAKKAEVNTIPGFDVKDAEEAVRIARE
3dluD           ---------------------GRFV-VWPSELDSRLSRKYGRIVPRSIAVESPRV------EEIVRAAEE
3czqB           --INIGREQLKRFHDRRHDPLKIWKLPDIAALSKWDDYTGKRDRLKETHTEHGPWAVIRGNDKR-----R
3cwcB           ----------------------VITGEGRIDSQTIHGKVPIGVIAKRYNKPVIGIAGSLTAHGLDAVFSV
1b57A           --------------------------DFVKPGVITGDDVQKVFQVAKENNFALPAVGTDSINAVLETAAK
2abrB           ---YGMNIRREEKTFLEVVAESLLKKLRVVETGAAEREQ-WDDGNNVVCLEPGVVVGYDRNTYTNTLLRK
2afrA           --STRAIESIQKANSFNLLNESIVIGNAPTALLEIEKLIRQEGIKPALIVGVPVGFVKESKESILKLEYY
2afvA           -----------------------VIGNAPTALLEIEKLIRQEGIKPALIVGVPVGFVKESKESILKLEYY
2cyzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TGWPVVLKAARGGYDGKGVWVVGDXXXXXXXXXXXXXXQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
1a9xA           VGFPCIIR-PSFTMGGSGGGIAREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVC
2c00B           VGYPVIIKAAGGGM-RVVYDESELIKSAKLTRTEAGAGNPMVYLEKFLTNPRHVEVQVLSDGQGNAHLGD
1ce8A           VGFPCIIR-PSFTMGGSGGGIAREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVC
1b6sB           LGELAIVKRRTGGY-DGRGQWR---LRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYP
1dv1A           IGYPVIIKASMRVVRGDAELA-------QSISMTRAEANDMVYMEKYLENPRHVEIQVLADGQGNAIYLA
1dv2A           IGYPVIIKASGGG-GGRGMRVVAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAYLAE
1c30A           VGFPCIIR-PSFTMGGSGGGIAREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVC
1dv2B           IGYPVIIKASGGG-GGRGMRVVAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAYLAE
2dzdB           HGYPIIIKAALGGG-GRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIENPKHIEVQILGDYEGNIHLYE
1bxrA           VGFPCIIRPSFTM-GGSGGGIAREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKNDNCIIVC
2c00A           VGYPVIIKAAGGRGMRVVYDESELIKSAKLTRTEAGFGNPMVYLEKFLTNPRHVEVQVLSDGQGNAIHGD
1b6sC           LGELAIVKRRTGGQ-WRLRANE--------TEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYP
2dzdA           HGYPIIIKAALGG-GGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIENPKHIEVQILGDYEGNVHLYE
3d2oA           HSMKVMIPVT--SLCPCSKEISQY-----------GAHNQRSHVTVSLTSDAEVGIEEVIDYVETQASCQ
3e5nA           LGLPLFVK-PANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVAG-REIECAVLGNAVPHASVCG
1bncA           IGYPVIIKRGMRVVRGDAELA--------QSISMTRAEAKMVYMEKYLENPRHVEIQVLADGQGNAIYLE
3bg5A           AGFPLMIKATSRIVREESELE--DAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEHGNVHLFE
3d2oB           YGHSMKVMIPVTSLCPCSKEISQY-----------GAHNQRSHVTVSLTSDAEVGIEEVIDYVETQASCQ
2czgA           IGYPCHTKAI-MSYFVKGPED-------------IPKAWEKIIVEEHIDFDVEVTELAVRHFDENGEIVT
3bg5C           AGFPLMIKATSGG-GGKGMRIVREESELEDAFHRAKSEAEEVYIERYIDNPKHIEVQVIGDEHGNIVHLE
2dwcB           IGYPCHTKAIM-SGSYFVKGPEDI---------PKAWEEEKIIVEEHIDFDVEVTELAVRHFDENGEIVT
1b6sA           LGELAIVKRRTGG-GQWRLRANETEQLPAECYG-------ECIVEQGINFSGEVSLVGARGFDGSTVFYP
1dv1B           IGYPVIIKMRVVRGDAELAQSISMT---------------RAYMEKYLENPRHVEIQVLADGQGNAIYLA
3bg5B           EGIKFIGPHLEHL-DMFGDKVKARTTAIK---------ADLPVIPIDNPKHIEVQVIGDEHGNI-VHLFE
1bncB           IGYPVIIK-RVVRGDAELAQSISMT---------------RAYMEKYLENPRHVEIQVLADGQGNAIYLA
3bg5D           EGIKFIGPHLEHL-DMFGDKVKARTTAIK---------ADLPVIPIDNPKHIEVQVIGDEHGNIVHL-FE
2czgB           IGYPCHTKAI-SYFVKGPEDIPKAW---------------KIIVEEHIDFDVEVTELAVRHFDENGEIVT
3d8nA           LGLDLEGPLAKAFRLARGAKAARALKEAGLPPHAVGDGTSKSLLPLLPQGRGVAALQLYGKPLP-----L
3d8tA           DLEGPLAKAFRLARGAKAARALKEAGLPPHAVGDGT---SKSLLPLLPQGRGVAALQLYGKPLPLLENAL
3df7A           LDCKFIIKPRTACI-GFSDEVPDGH------------------IAQEFIEGINLSVSLAVG--EDVKCLS
1ehiA           LGNIVFVKAA-NQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIG
1b6rA           LGELAIVKRRTGQWRLRANETEQLPAECYG----------ECIVEQGINFSGEVSLVGARGFDGSTVFYP
1ehiB           LGNIVFVKAA-NQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIG
3d8rA           DLEGPLAKAFRLARGAKAARALKEAGLPPHAVGDGT---SKSLLPLLPQGRGVAALQLYGKPLP-----L
1auvB           TTYPVVVKGHAH---SGGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYRLEQ
2dwcA           IGYPCHTKAIMSYF-VKGPEDIPKAWEE-----------EKIIVEEHIDFDVEVTELAVRHFDENGEIVT
3d8tB           DLEGPLAKAFRLARGAKAARALKEAGLPPHAVGDGT---SKSLLPLLPQGRGVAALQLYGKPLP-----L
1auvA           TTYPVVVKGHAH---SGGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYRTLE
1e4eB           FTYPVFVKPARSGS-SFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLDQIRLQYGIFRI
1cqjB           IGAPWVVKCQAGGVKNSKEDIRAFKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRVVFM
1dosA           VKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAPVILHTDHCAKKLLPWIDGLLDAGEKHFAAT
2dxcF           ----------------------------------------DFEILEMAVRELAIEKGLFSAEDHRVWKDY
3e7dB           RGVPYVIVRGRRGGSAMTAAAV------------------------------------------------
2bv8B           AEQPQLIQPG-GAYTNRRMAACDMEIVLRYVSYAEIAGDSSVLDDRCLNGLRETYQALGTPGSSVAVAIE
3czqD           -RINVIRHLTKLDYDGKDEAAIGE----------------------------------------------
3e7dA           RGVPYVIVRGRRGGSAMTAAAV------------------------------------------------
1e4eA           FTYPVFVK-PARSGSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVG-CAVLGNSAALVVGEV
3czqA           SRINVIRHLTKLDYDGKDEAAIGE----------------------------------------------
2dd4F           -------------------------------------------VSDFEILEMAVRKGLFSAEDHRVWKDY
3czqC           --INVIRHLTKLDYDGKDEAAIGE----------------------------------------------
3e7dC           RGVPYVIVRGRRGGSAMTAAAV------------------------------------------------
2cqyA           IGYPVMIKASAGGG-GKGMRIAWDDEETRDGFRLSSQEAARLLIEKFIDNPRHISGPS------------
3dluD           LKFKVIRVEEDKLLRTFGMIVL------------------------------------------------
3czqB           SRINVIRHLTKLDYDGKDEAAIGE----------------------------------------------
3cwcB           IYTICTLEDALKN-ASENVRTARN----------------------------------------------
1b57A           VKAPVIVQFSNGGASFIAGK--------------------------------------------------
2abrB           AGVEVITISASELGRGRGGGH-------------------------------------------------
2afrA           NVTSILTMGRKGG---------------------------------------------------------
2afvA           NVTSILTMGRKGGS--------------------------------------------------------
2cyzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VVETVQRGGICHEVIAPAPHLSEDRXXXXXXXXXXXXXXXXXXXXXXXELFETDTGVVVNELAMRPHNSG
1a9xA           SIENFDAMGIDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFPKNGRLIVIEMNPRVSRSS
2c00B           RDCSLQRRHQKVIEEAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVEH
1ce8A           SIENFDAMGIHTITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFPKNGRLIVIEMNPRVSRSS
1b6sB           LTHNLHQDGILRTSVAFP-QANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
1dv1A           ERCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEH
1dv2A           RDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVEH
1c30A           SIENFDAMGIHTITVAPAQTLTDKIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMNPRVSRSS
1dv2B           RDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQVEH
2dzdB           RDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVEH
1bxrA           SIENFDAMGIHTITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFPKNGRLIVIEMNPRVSRSS
2c00A           RDCSLQRRHQKVIEEAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYFIEMNTRVQVEH
1b6sC           LTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAM-ECFVTPQGLLINELAPRVHNSG
2dzdA           RDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVEH
3d2oA           LYGLLKRPDEKYVTEKAYE--NPKFVEDMVRDVATSLIADKRIKSFVVESE--------NFESIHNHS--
3e5nA           EVVV---------EIVIPADIDAQTQQRIQQIAVQAYQALGCAGMARVDVFLCADGIVINEVNTLPGFTR
1bncA           RDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEH
3bg5A           RDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEH
3d2oB           LYGLLKRPDEKYVTEKAYEN--------------------------------------------------
2czgA           TFPHYQIDGDYHAS-WQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
3bg5C           RDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEH
2dwcB           TFPKPVGHYQIDGASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
1b6sA           LTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAM-ECFVTPQGLLINELAPRVHNSG
1dv1B           ERDSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEH
3bg5B           RDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEH
1bncB           RDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEH
3bg5D           RDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEH
2czgB           TFGHYQIDGDYHASWQPAE-ISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
3d8nA           LENALAERGYRVLPLMPYRHLPDPLRLEEAVLRGEVDALAFVAAIQVEFLFEGAKDPKALREALNTRVKA
3d8tA           -----AERGYRVLPLMPYRHLPDPLRLEEAVLRGEVDALAFVAAIQVEFLFEGAKDPKALREALNTRVKA
3df7A           VNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSD-QPYVIEINARLTTPV
1ehiA           AHTVPNQGSGDGWHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNPYLGEPNTLPGFTN
1b6rA           LTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAM-ECFVTPQGLLINELAPRVHNSG
1ehiB           AHT--------VHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTN
3d8rA           LENALAERGYRVLPLMPYRHLPDPLRLEEAVLRGEVDALAFVAAIQVEFLFEGAKDPKALREALNTRVKA
1auvB           IASDRYK----LWVDTCSEIF------------------GGLDICAVEALHGKDGRDHIIEVVGSSPLIG
2dwcA           TFPKPYQIDGDYHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
3d8tB           LENALAERGYRVLPLMPYRHLPDPLRLEEAVLRGEVDALAFVAAIQVEFLFEGAKDPKALREALNTRAVG
1auvA           QIASDRYKLWVDTCSEIFGGLD---------------------ICAVEALHGKDGRDHIIEVVGSSPLIG
1e4eB           HQEVEPEKGSENAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQRGRIVLNEVNTLPGFTS
1cqjB           AIEKVAEETPHLIHKVALDPLTGPRELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQ
1dosA           GKPLFSSHMISEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDSALYTQPEDVDYAY
2dxcF           VHTLGP--LPAARLVAKAWLDPEYKKLCIEDGVEASKAVGVNWVTSPPTQFSDYCNLRVLADSPTLKHVV
3e7dB           ----------------------------------------------------------------------
2bv8B           KMKEASVSDANDSSGTPSG-DCSS----------------------------------------------
3czqD           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
1e4eA           DQIRLQYGIENAVITVPADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQDNGRIVLNEVNTLPGFTS
3czqA           ----------------------------------------------------------------------
2dd4F           VHTLGPLP--AARLVAKAW-LDPELCIEDGVEASKAVGVNWVTSPPTQFGTPSDYCNLRVLADSPT---L
3czqC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
2cqyA           ----------------------------------------------------------------------
3dluD           ----------------------------------------------------------------------
3czqB           ----------------------------------------------------------------------
3cwcB           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
2afrA           ----------------------------------------------------------------------
2afvA           ----------------------------------------------------------------------
2cyzA           --------------------------------------------------YDTTAETRYMVLPQRPAGTE


                         .         *         .         .         .         .         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
1a9xA           ALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASFEPSIDYVV----TKIPRFNFEKFAGANDRL
2c00B           PVSEMVTGVDIVKEMLRIASGEKLSEDVVIRGHALECRINAEDPKTKHFHAPGGNGVRVDSHLYSGYSPP
1ce8A           ALASKATGFPIAKVAAKLAVGYTLDEMNDITGGRTPASFEPSIDYVV-----TKIPRFNFEKFAGANDRL
1b6sB           HWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYD--------WLKLPLVHLHWYDKEV
1dv1A           PVTEMITGVDLIKEQLRIAAGQPLSEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAPGGFGVYTVPP
1dv2A           PVTEMITGVDLIKEQLRIAAGQPLSIEEVHVRGHAVECRINAEDPNTFLPSPGKITRAPGGFGVRWESHI
1c30A           ALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASFEPSIDYVV----TKIPRFNFEKFAGANDRT
1dv2B           PVTEMITGVDLIKEQLRIAAGQPLSIEEVHVRGHAVECRINAEDPNTFLPSPGKITRAPGGFGVRWESHI
2dzdB           TITEMITGIDIVQSQILIADGCSLHSHEVGIPKQEDIRINGTGKIMAYRSGGGFGVRLDAGNGFQGAVTP
1bxrA           ALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASFEPSI----DYVVTKIPRFNFEKFAGANDRT
2c00A           PVSEMVTGVDIVKEMLRIASGEKLSEDVVIRGHALECRINAEDPKTFMPSPGKVKHFRVDSHLYSGYSPP
1b6sC           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLI-GSDVNYDWLKL------PLVHLHWYDKEV
2dzdA           TITEMITGIDIVQSQILIADGCSLHSHEVGIPKQEDIRINGGKIMAYRSGGGFGVRLDAGNGFQGAVITP
3d2oA           ----------------------------------------------------------------------
3e5nA           ISVYPKLWQADYRGLITRLIELALER--------------------------------------------
1bncA           PVTEMITGVDLIKEQLRIAAGQPLSEEVHVRGHAVECRINAEDPNTPSPGKITRFHAPGGFGVRWYTVPP
3bg5A           TITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGTGTIIAYRSSGGFGVRLDAGDGFQGAESP
3d2oB           ----------------------------------------------------------------------
2czgA           MVTLASHPPSEFALHLRAVLGLPIPGEWVDGYRLFPMLIIKAKVSGYSPRFLVKALSVPNATVRLFGKEA
3bg5C           TITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGDFMPDTGTIIAYRSSGGFGVRLDGAEISP
2dwcB           MVTLASHPPGEFALHLRAVLGLPIPGEWVDGYRLFPMLIIKAKVSGYSPRFLVKALSVPNATVRLFGKEA
1b6sA           HWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVN--------YDWLKLPLVHLHWYDKEV
1dv1B           PVTEMITGVDLIKEQLRIAAGQPLSEEVHVRGHAVECRINAEDPNTPSPGKITRFHAPGGFGVRWYTVPP
3bg5B           TITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGTGTIIAYRSSGGFGVRLDAGDGFQGAESP
1bncB           PVTEMITGVDLIKEQLRIAAGQPLSEEVHVRGHAVECRINAEDPNTPSPGKITRFHAPGGFGVRWYTVPP
3bg5D           TITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGDFMPDTGTIIAYRSSGGFGVDGFQGAESP
2czgB           MVTLASHPPSEFALHLRAVLGLPIPGEWVDGYRLFPMLIKVSGYSPRFRGLVKALSVPNATVRLFGKPEA
3d8nA           LAVGRVTADALREWGVKPFYVDETERL-------------------------------------------
3d8tA           LAVGRVTADALREWGVKPFYVDETERL-------------------------------------------
3df7A           VAFSRAYGASVADLLAGGEVKHVRRQVR------------------------------------------
1ehiA           MSLFKRLWDYNNAKLVDMLIDYGFEDFAQNKKLS------------------------------------
1b6rA           HWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLI--GSDVN------YDWLKLPLVHLHWYDKEV
1ehiB           MSLFKRLWDYNNAKLVDMLIDYGFEDFA------------------------------------------
3d8rA           LAVGRVTADALREWGVKPFYVDETERL-------------------------------------------
1auvB           DHQDEDKQLELVVNKAQA----------------------------------------------------
2dwcA           MVTLASHPPGEFALHLRAVLGLPIPGEWVDGYRLFPMLIPAATHVIKAKVSGYKALSVPNATVRLFGKEA
3d8tB           RVTADALREWGVKPFYVDET--------------------------------------------------
1auvA           DHQDEDKQLELVVNKAQA----------------------------------------------------
1e4eB           YSRYPRMMISLPELIDRLIV--------------------------------------------------
1cqjB           GDLICLDGKLGADGNALFRQPDLRERDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVK
1dosA           TELSKISPRFTIAASFGNVHGVYKAGNVVLTPTILRDEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSV
2dxcF           VCTLSYPRPILG--QSPEWYRSPNYRRRLVRWPRQVLAEFGLQLPSEVQ--IRVADSNQKTGWTEDQLAE
3e7dB           ----------------------------------------------------------------------
2bv8B           ----------------------------------------------------------------------
3czqD           ----------------------------------------------------------------------
3e7dA           ----------------------------------------------------------------------
1e4eA           YSRYPRMMISLPELIDRLIV--------------------------------------------------
3czqA           ----------------------------------------------------------------------
2dd4F           KHVVVCTLCSCYPRPILGQSPEWYRSPNYRRRLVRWQVLAEFGLQLPSEVQIRVADSNQKTRTEDQLAEI
3czqC           ----------------------------------------------------------------------
3e7dC           ----------------------------------------------------------------------
2cqyA           ----------------------------------------------------------------------
3dluD           ----------------------------------------------------------------------
3czqB           ----------------------------------------------------------------------
3cwcB           ----------------------------------------------------------------------
1b57A           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
2afrA           ----------------------------------------------------------------------
2afvA           ----------------------------------------------------------------------
2cyzA           GWSQE-----QLQEIVTKDCLIGVAIPQV-----------------------------------------


                         .         .         .         .         *         .         .:420
query           RPGRKIGHVTVVGDDPxxxxxxxxxxxxxxxxxxx
1a9xA           TQMKSVGEVMAIGRTQ-------------------
2c00B           NYDSLVGKVITYGAD--------------------
1ce8A           TQMKSVGEVMAIGRTQ-------------------
1b6sB           RPGRKVGHLNLTDSDT-------------------
1dv1A           YYDSMIGKLICYGEN--------------------
1dv2A           YYDSMIGKLICYGEN--------------------
1c30A           TQMKSVGEVMAIGRTQ-------------------
1dv2B           YYDSMIGKLICYGEN--------------------
2dzdB           YYDSLLVKLSTWALT--------------------
1bxrA           TQMKSVGEVMAIGRTQ-------------------
2c00A           NYDSLVGKVITYGAD--------------------
1b6sC           RPGRKVGHLNLTDSDT-------------------
2dzdA           YYDSLLVKLSTWALT--------------------
3d2oA           -----------------------------------
3e5nA           -----------------------------------
1bncA           YYDSMIGKLICYGEN--------------------
3bg5A           YYDSLLVKLSTHAIS--------------------
3d2oB           -----------------------------------
2czgA           YVGRRLGIALAWDKD--------------------
3bg5C           YYDSLLVKLSTHAISF-------------------
2dwcB           YVGRRLGIALAWDKD--------------------
1b6sA           RPGRKVGHLNLTDSD--------------------
1dv1B           YYDSMIGKLICYGEN--------------------
3bg5B           YYDSLLVKLSTHAIS--------------------
1bncB           YYDSMIGKLICYGEN--------------------
3bg5D           YYDSLLVKLSTHAISF-------------------
2czgB           YVGRRLGIALAWDKD--------------------
3d8nA           -----------------------------------
3d8tA           -----------------------------------
3df7A           -----------------------------------
1ehiA           -----------------------------------
1b6rA           RPGRKVGHLNLTDSDT-------------------
1ehiB           -----------------------------------
3d8rA           -----------------------------------
1auvB           -----------------------------------
2dwcA           YVGRRLGIALAWDKD--------------------
3d8tB           -----------------------------------
1auvA           -----------------------------------
1e4eB           -----------------------------------
1cqjB           LHGGEPANFLDVGGGA-------------------
1dosA           SYG--VVKMNIDTDT--------------------
2dxcF           IVTRDIGVAVPKPGI--------------------
3e7dB           -----------------------------------
2bv8B           -----------------------------------
3czqD           -----------------------------------
3e7dA           -----------------------------------
1e4eA           -----------------------------------
3czqA           -----------------------------------
2dd4F           VTRDCIGVAVPKPGI--------------------
3czqC           -----------------------------------
3e7dC           -----------------------------------
2cqyA           -----------------------------------
3dluD           -----------------------------------
3czqB           -----------------------------------
3cwcB           -----------------------------------
1b57A           -----------------------------------
2abrB           -----------------------------------
2afrA           -----------------------------------
2afvA           -----------------------------------
2cyzA           -----------------------------------