[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56592.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "1dxlA.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "2b76M.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2cduA.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "1b37B.bssp"
#ERROR : Can't open dsspfile "3cirA.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "1d5tA.bssp"
#ERROR : Can't open dsspfile "2c72A.bssp"
#ERROR : Can't open dsspfile "2bs2A.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "3bg7A.bssp"
#ERROR : Can't open dsspfile "2b76A.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "3d1cA.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "1aogA.bssp"
#ERROR : Can't open dsspfile "2c76B.bssp"
#ERROR : Can't open dsspfile "2e5vA.bssp"
#ERROR : Can't open dsspfile "2a87A.bssp"
#ERROR : Can't open dsspfile "2c73A.bssp"
#ERROR : Can't open dsspfile "3cp8A.bssp"
#ERROR : Can't open dsspfile "3cesD.bssp"
#ERROR : Can't open dsspfile "2a87B.bssp"
#ERROR : Can't open dsspfile "2bk4B.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "3bg6A.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "3cesB.bssp"
#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "3cpjG.bssp"
#ERROR : Can't open dsspfile "2a0iA.bssp"
#ERROR : Can't open dsspfile "3ef6A.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "1coyA.bssp"
#ERROR : Can't open dsspfile "2bk4A.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "2c72B.bssp"
#ERROR : Can't open dsspfile "3blyA.bssp"
#ERROR : Can't open dsspfile "2c76A.bssp"
#ERROR : Can't open dsspfile "3cphG.bssp"
#ERROR : Can't open dsspfile "3cpiG.bssp"
#ERROR : Can't open dsspfile "3cesA.bssp"
#ERROR : Can't open dsspfile "3cpiH.bssp"
#ERROR : Can't open dsspfile "2c75A.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "3cp2A.bssp"
#ERROR : Can't open dsspfile "3cetA.bssp"
#ERROR : Can't open dsspfile "3cphH.bssp"
#ERROR : Can't open dsspfile "1e6eA.bssp"
#ERROR : Can't open dsspfile "1az3B.bssp"
#ERROR : Can't open dsspfile "1chuA.bssp"
#ERROR : Can't open dsspfile "2bmaA.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "2c73B.bssp"
#ERROR : Can't open dsspfile "2ciqA.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"
#ERROR : Can't open dsspfile "3cetB.bssp"
#ERROR : Can't open dsspfile "2dkhA.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "2c7gA.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "1bkwA.bssp"
#ERROR : Can't open dsspfile "2culA.bssp"
#ERROR : Can't open dsspfile "3datA.bssp"
#ERROR : Can't open dsspfile "2bmuB.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "3b6dA.bssp"
#ERROR : Can't open dsspfile "1b8sA.bssp"
#ERROR : Can't open dsspfile "3cesC.bssp"
#ERROR : Can't open dsspfile "3e1tA.bssp"
#ERROR : Can't open dsspfile "3dbhB.bssp"
#ERROR : Can't open dsspfile "2bmuA.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "3dbrD.bssp"
#ERROR : Can't open dsspfile "3cp8D.bssp"
#ERROR : Can't open dsspfile "3d4oA.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "3c4nA.bssp"
#ERROR : Can't open dsspfile "1cboA.bssp"
#ERROR : Can't open dsspfile "2apgA.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "2du8A.bssp"
#ERROR : Can't open dsspfile "3cnjA.bssp"
#ERROR : Can't open dsspfile "3dbhF.bssp"
#ERROR : Can't open dsspfile "1d4cB.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1an9A.bssp"
#ERROR : Can't open dsspfile "2bxrA.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "1cc2A.bssp"
#ERROR : Can't open dsspfile "2bxsA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "3d4oB.bssp"
#ERROR : Can't open dsspfile "2apjA.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "3da1A.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "3cntB.bssp"
#ERROR : Can't open dsspfile "3bi2A.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"
#ERROR : Can't open dsspfile "1cj3A.bssp"
#ERROR : Can't open dsspfile "3cnpA.bssp"
#ERROR : Can't open dsspfile "3cnsB.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "3bi4A.bssp"
#ERROR : Can't open dsspfile "3bi4B.bssp"
#ERROR : Can't open dsspfile "3dl2B.bssp"
#ERROR : Can't open dsspfile "1cj4A.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "3bi2B.bssp"
#ERROR : Can't open dsspfile "2b9wA.bssp"
#ERROR : Can't open dsspfile "1bgnA.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"
#ERROR : Can't open dsspfile "3cirM.bssp"
#ERROR : Can't open dsspfile "3c4aA.bssp"
#ERROR : Can't open dsspfile "3cnsA.bssp"
#ERROR : Can't open dsspfile "1c0iA.bssp"
#ERROR : Can't open dsspfile "3bhfA.bssp"
#ERROR : Can't open dsspfile "1e0dA.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "1dobA.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "1a48A.bssp"
#ERROR : Can't open dsspfile "1auvB.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "1b3mA.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "1dv1B.bssp"
#ERROR : Can't open dsspfile "2ardA.bssp"
#ERROR : Can't open dsspfile "3c96A.bssp"
#ERROR : Can't open dsspfile "1do8A.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"

## Summary of PDB Search
:460
    6e-76  27%  1bhyA  [x.x.x] P64K
    2e-72  30%  1dxlA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    6e-72  27%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    9e-69  26%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    3e-64  33%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    1e-63  29%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    2e-60  18%  2bc0A  [x.x.x] NADH OXIDASE
    9e-57  18%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    1e-55  24%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-55  18%  2cduB  [x.x.x] NADPH OXIDASE
    1e-50  23%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    9e-50  11%  2b76M  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    2e-49  23%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-49  23%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    5e-49  21%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    2e-48  10%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    6e-48  17%  2bc1A  [x.x.x] NADH OXIDASE
    6e-47  17%  2cduA  [x.x.x] NADPH OXIDASE
    1e-46  20%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    9e-46   9%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    7e-44  10%  1b37B  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    9e-44  11%  3cirA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    4e-43  22%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    6e-43  10%  1d5tA  [c.3.1 - d.16.1] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR
    9e-43   8%  2c72A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    4e-42  12%  2bs2A  [c.3.1 - d.168.1 - a.7.3 (1e7pA)] QUINOL-FUMARATE REDUCTASE
    8e-42  26%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    2e-41  10%  3bg7A  [x.x.x] PYRANOSE OXIDASE
    7e-41  11%  2b76A  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    2e-40  21%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    2e-40  18%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    6e-40  11%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    1e-39  13%  3d1cA  [x.x.x] FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE
    4e-39  23%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    5e-39  26%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    5e-39  24%  1aogA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    6e-39  11%  2c76B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    2e-38   9%  2e5vA  [x.x.x] L-ASPARTATE OXIDASE
    3e-38  21%  2a87A  [x.x.x] THIOREDOXIN REDUCTASE
    9e-38  12%  2c73A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    2e-37  14%  3cp8A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-36  15%  3cesD  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    4e-36  21%  2a87B  [x.x.x] THIOREDOXIN REDUCTASE
    2e-35  11%  2bk4B  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    2e-35  25%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    3e-35   9%  3bg6A  [x.x.x] PYRANOSE OXIDASE
    9e-35  14%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    1e-33  17%  3cesB  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-33  14%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    2e-33   9%  3cpjG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    3e-33   9%  2a0iA  [x.x.x] TRAI PROTEIN
    6e-33  20%  3ef6A  [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--
    9e-33  20%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    1e-32  11%  1coyA  [x.x.x] CHOLESTEROL OXIDASE
    1e-31  11%  2bk4A  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    2e-31  24%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    4e-31   9%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    6e-31  12%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    8e-31  10%  2c72B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    9e-31  11%  3blyA  [x.x.x] PYRANOSE OXIDASE
    5e-30  11%  2c76A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    2e-29   8%  3cphG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    3e-29   9%  3cpiG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    3e-29  17%  3cesA  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    7e-29   8%  3cpiH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    1e-28   9%  2c75A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    1e-27  15%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    1e-27  14%  3cp2A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-26   8%  3cetA  [x.x.x] CONSERVED ARCHAEAL PROTEIN
    3e-26   8%  3cphH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    5e-25  13%  1e6eA  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    4e-24   8%  1az3B  [c.52.1] ECORV ENDONUCLEASE
    4e-24  15%  1chuA  [c.3.1 - d.168.1 - a.7.3] PROTEIN (L-ASPARTATE OXIDASE)
    9e-24   7%  2bmaA  [x.x.x] GLUTAMATE DEHYDROGENASE (NADP+)
    9e-24  14%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    4e-23  12%  2c73B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    1e-22  10%  2ciqA  [x.x.x] HEXOSE-6-PHOSPHATE MUTAROTASE
    1e-19  17%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-18  10%  3cetB  [x.x.x] CONSERVED ARCHAEAL PROTEIN
    7e-15   8%  2dkhA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    3e-14  10%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    2e-13  11%  2c7gA  [x.x.x] NADPH-FERREDOXIN REDUCTASE FPRA
    2e-12  13%  2brxA  [x.x.x] URIDYLATE KINASE
    4e-12   7%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069
    4e-12  13%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    6e-11   9%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505
    6e-11  12%  1bkwA  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    7e-11  15%  2culA  [x.x.x] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED
    1e-10   9%  3datA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-10  13%  2bmuB  [x.x.x] URIDYLATE KINASE
    3e-10   8%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    4e-10  12%  3b6dA  [x.x.x] CHOLESTEROL OXIDASE
    4e-10  12%  1b8sA  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    1e-09  26%  3cesC  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    3e-09  12%  3e1tA  [x.x.x] HALOGENASE
    3e-09  12%  3dbhB  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    9e-09  15%  2bmuA  [x.x.x] URIDYLATE KINASE
    2e-08  20%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    3e-08  11%  3dbrD  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    3e-08  18%  3cp8D  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    3e-08  10%  3d4oA  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    4e-08  24%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    5e-08  25%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    7e-08  13%  3c4nA  [x.x.x] UNCHARACTERIZED PROTEIN DR_0571
    2e-07  12%  1cboA  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    3e-07  32%  2apgA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    3e-07  25%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-07  19%  2du8A  [x.x.x] D-AMINO-ACID OXIDASE
    5e-07  10%  3cnjA  [x.x.x] CHOLESTEROL OXIDASE
    5e-07  11%  3dbhF  [x.x.x] NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    1e-06  44%  1d4cB  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    2e-06  16%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-06  19%  1an9A  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    2e-06  16%  2bxrA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    3e-06  25%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-06  45%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    5e-06  12%  1cc2A  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    5e-06  35%  2bxsA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    6e-06  25%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    7e-06  44%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    7e-06  15%  3d4oB  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    9e-06  16%  2apjA  [x.x.x] PUTATIVE ESTERASE
    1e-05  33%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    1e-05  27%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  15%  3da1A  [x.x.x] GLYCEROL-3-PHOSPHATE DEHYDROGENASE
    2e-05  24%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  43%  3cntB  [x.x.x] FMS1
    2e-05  43%  3bi2A  [x.x.x] POLYAMINE OXIDASE FMS1
    2e-05  44%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    2e-05  25%  1cj3A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  43%  3cnpA  [x.x.x] FMS1
    3e-05  39%  3cnsB  [x.x.x] FMS1
    4e-05  16%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    4e-05  31%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    4e-05  43%  3bi4A  [x.x.x] POLYAMINE OXIDASE FMS1
    4e-05  40%  3bi4B  [x.x.x] POLYAMINE OXIDASE FMS1
    4e-05  24%  3dl2B  [x.x.x] UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 3
    4e-05  39%  1cj4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    5e-05  27%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    5e-05  40%  3bi2B  [x.x.x] POLYAMINE OXIDASE FMS1
    6e-05  44%  2b9wA  [x.x.x] PUTATIVE AMINOOXIDASE
    6e-05  24%  1bgnA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    7e-05  14%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
    7e-05   9%  3cirM  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    8e-05  23%  3c4aA  [x.x.x] PROBABLE TRYPTOPHAN HYDROXYLASE VIOD
    9e-05  40%  3cnsA  [x.x.x] FMS1
    1e-04  35%  1c0iA  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    1e-04  21%  3bhfA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    1e-04  21%  1e0dA  [c.5.1 - c.72.2 - c.59.1]
    1e-04  29%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-04  27%  1dobA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-04  26%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    2e-04   8%  1a48A  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    4e-04   5%  1auvB  [c.30.1 - d.142.1] SYNAPSIN IA
    4e-04  32%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    5e-04  19%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-04  21%  1b3mA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    6e-04  19%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    6e-04  14%  1dv1B  [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
    6e-04  34%  2ardA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    8e-04  16%  3c96A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    9e-04  15%  1do8A  [c.58.1 - c.2.1] MALIC ENZYME
    4e-04  17%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE(query 3->32)
    4e-04  17%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346(query 3->32)
    2e-05  17%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069(query 3->32)
    6e-05  23%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505(query 3->32)
    0.001  32%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE(query 172->211)
    3e-05  35%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL(query 3->33)
    2e-04  34%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE(query 3->31)
:460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
1bhyA           --DVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHL------
1dxlA           ---VVIIGGGPGGYVAAIKAAQLGFKTTCIEKRGLGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGVK
1dncA           VASYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGV-PKKVMWNTAVHSEFMHDHADYGFPS
3dk9A           ---YLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPS
1ebdA           ---TLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKA
2a8xA           ---VVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTKDAKAFGIS
2bc0A           --KIVVVGANHAGTACIKTMLTNYGDANEIVVFDQNSNISFLGGMALWIGEQIAGPEGLFYSDKEELESL
2cfyA           ---------------KKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
3eanC           ---LIIIGGGSGGLAAAVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
2cduB           --KVIVVGCTHAGTFAVKQTIADHPDADVTAYEMNDNISFLSGIALYLGKEIKNNDPRGLFYSSPEELSN
3eanF           ---LIIIGGGSGGLAAAVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
2b76M           FHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWS----RRPDGSVNVRRFGGMKIERTWFAADKT
3eanD           ---LIIIGGGSGGLAAAVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
3eanA           ---LIIIGGGSGGLAAAVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
3cgcA           --NYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDK
1b37A           --RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKNFAGINVELGANWVEGVNGGKMNPIWP
2bc1A           --KIVVVGANHAGTACIKTMLTNYGDANEIVVFDQNSNISFLGSGMALWIGEQIAGPEGLFYSDKEELES
2cduA           --KVIVVGCTHAGTFAVKQTIADHPDADVTAYEMNDNISFLSGIALYLGKEIKNNDPRGLFYSSPEELSN
3cgbA           ---YVIIGGDAAGSAAQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKT------
2c75B           --DVVVVGGGISGMAAAKLLHDSGLNVVVLARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
1b37B           --RVIVVGAGMSGISAAKRLSEAGITDLLILATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWP
3cirA           FHDTVAGGDWLCEQDVVDYFVHHCPTEMTQ----LELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKT
3dh9A           ---LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAV
1d5tA           MDEVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPETMGRGRDWN
2c72A           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
2bs2A           ---SLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSH-------------------------------
3dghB           ---LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWG--------------------------
3bg7A           MDIVVIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVIQGQLMSVS
2b76A           FHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHM
1d7yA           --PVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLD---------
1bzlA           MSKLVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVTGAQYMEHL
3coxA           --PALVIGSGYGGAVAALRLTQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADKTDQPVSNF
3d1cA           ---VAIIGAGAAGI-GAITLKDFGITDVIIL--EKGTVGHSFKHWPKSTRTITPSFTSNGFGPDNAISDT
3ctyB           ---VVIVGAGAAGFSAAVYAARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSI----------------
3dghA           ---LIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGV-------------------------
1aogA           ----------------------------------------------------------------------
2c76B           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYLRNQKVKYVDLGGSYVGPTQNRILRLA--
2e5vA           --KVTLISKRIDGGSTPIAKGGVAASVGSDDSPQDTIRVGDGLCDVKTVNYVTSEAKNVIETFESWGFEF
2a87A           VRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDE-------
2c73A           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
3cp8A           ---VIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQITREIDALGGEMGKAID
3cesD           ---VIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS--CNPAIGGIGKGHLVKEVDALGGLMAKA
2a87B           --DVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNG----------------
2bk4B           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAK-
1aogB           IFDLVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALG------------------------
3bg6A           MDIVVIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVIQGQLMSVS
1djnA           ----------------------------------------------------------------------
3cesB           ---VIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLG--QMSCNPAIGGIGKGHLVKEVDALGGLMAKA
1e6eC           --QICVVGSGPAGFYTAQHLLKHHSRAHVDEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFY
3cpjG           IDTVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEEKDRDWNVDL
2a0iA           ----------------------------------------------------------------------
3ef6A           -THVAIIGNGVGGFTTAQALRAEGFE--------------------------------------------
1cl0A           -SKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATK
1coyA           ---ALVIGSGYGGAVAALRLTQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADKTDQPVSNF
2bk4A           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEADRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
3ctyA           ---VVIVGAGAAGFSAAVYAARSGFSVAILDKAVAGGLTAEAPLVENYLG--------------------
2bi7A           SKKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGGNSYDARDSETNVMVHVYGPHIFHTDNETVWNY
3bh1C           ----------------------------------------------------------------------
2c72B           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRI--LRL
3blyA           ---VVIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAKKNTVEYQKNIDKFVNVIQGQLMSVSV
2c76A           --DVVVVGGGISGMAAAKLLHDSGLNVVVLEADRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLA--
3cphG           IDTVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEISKEERESKFGKDRDWNVDL
3cpiG           ---VIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEERESKFGKDR
3cesA           ---VIIIGGGHAGTEAAMAAARMGQQTLLLTHN--IDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAKA
3cpiH           IDTVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVT--------------------------
2c75A           --DVVVVGGGISGMAAAKLLHDSGLNVVVLERDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
1djqA           ----------------------------------------------------------------------
3cp2A           ---VIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQM--SCNPAIGGIGKGHLVKEVDALGGLMAKA
3cetA           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
1e6eA           ----------------------------------------------------------------------
1az3B           ----------------------------------------------------------------------
1chuA           --QVIVLSKGPVTEFDETDSID------------------------------------------------
2bmaA           ---CWLDDNGVQRKNRCFRVQNSALGPYKGGLRFHPSVNLSIVKFLGFEQIFK---------NSLTGLSM
1cjcA           --QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLV---------------------------------
2c73B           --DVVVVGGGISGMAAAKLLHDSGLNVVVLERDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLA--
2ciqA           ----------------------------------------------------------------------
3d8xA           -NKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMR
3cetB           ----------------------------------------------------------------------
2dkhA           ---VLIVGCGPAGLTLAAQLAAFPDIRTCIVEQKEGPMELGQADGIACRTMEMFEAFEFADSILKEACWI
3b3rA           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKRSSWFKNRTEAPLGSF
2c7gA           --YIAIVGSGPSAFKAADTTEDLDMAVDMLE---------------------------------------
2brxA           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cc6A           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLRAGVDRRMARDGLVH
2cyjA           ----------------------------------------------------------------------
1bkwA           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIKAGVLEQGMVDLLREAGVDRRMARDGLV
2culA           ---VLIVGAGFSGAETAFWLAQKGVRVGLLTQLDAVMMPFLPPKPP-------------FPPGSLLERAY
3datA           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3cukA           --RVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLPQEADWSQQTFDY
3b6dA           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKWFKNRTEAPLGSFLWL
1b8sA           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKSSWFKNRTEAPLGSFL
3cesC           ---VIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMS--CNPAIGGIGKGH---LVKEVDALG---
3e1tA           VFDLIVIGGGPGGSTLASFVAMRGHRVLLLEREAFPRHQIGESLLPATVHGICAMLGLTDEMKRAGFPIK
3dbhB           ----------------------------------------------------------------------
2bmuA           ----------------------------------------------------------------------
3d4oC           --HVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDDGFIGVTKRIDE----------------------
3dbrD           ----------------------------------------------------------------------
3cp8D           MYDVIVVGAGHAGCEAALAVARGGLHCLLITSDMSCNPAIGGVAKGQITREIDALGGEMGKAIDATGIQL
3d4oA           --HVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDFIGVTKRI-----------------------DEV
2e4gB           IDKILIVGGGTAGWMAASYLGKALQGTTLLQAPDIPTLGVGEATIPNLQT--------------------
2e4gA           --KILIVGGGTAGWMAASYLGKALQGTADIQAPDIPTLGVGEATIPNLQT--------------------
3c4nA           ---IVVIGAGRGAACAFYLRQLAPGRSLLLEEGGLPNEEGATILAPGVWTAQDIPAGQEAQAEWTREQLL
1cboA           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIMLNPDKRSSWFKNRTEAPLGSFLWL
2apgA           --NIVIVGGGTAGWMAASYLVRALANITLIESAAIPRIGVGEATIPSLQKVF------------------
1cc4A           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQ---------------------
2du8A           --RVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAA--------------------
3cnjA           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKRSSWFTEAPLGSFLWL
3dbhF           ----------------------------------------------------------------------
1d4cB           ---VVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGN-------------------------------
2czgA           --KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVDKDFLWSVVEREKPDAIIPEIEA
1an9A           --RVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAA--------------------
2bxrA           ---VVVIGGGISGLSAAKLLTEYGVSVLVLERDRVGGR-------------TYTIRNEHVDYVDVGGAYV
1cj2A           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERRTPDYVLGRIRAGVLEQ---------------------
1d4dA           -TDVVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGN-------------------------------
1cc2A           ---AVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIMLNPDKRSSWFKNRTEAPLGSFLWL
2bxsA           MFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNE------------------------
2dwcB           ----------------------------------------------------------------------
1d4cC           ---VVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGN-------------------------------
3d4oB           --HVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDGFIGVTKR----------------------IDEV
2apjA           IKNLRHDLNLPSLPIIQVAIASGGGYIDKVREAQLGLKLSNVVCVDAKGLPLKSDNLHLTTEQVQLGLSL
3cgvA           TYDVLVVGGGPGGSTAARYAAKYGLKTLIEKRPEIGSPVRCGEGLS------------------------
1d7lA           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAG-------------------------
3da1A           ---LLVIGGGITGAGIALDAQVRGIQTGLVENDFASGTSSRSTKLVHGVGKERAIVYENAPHVTTPEWLL
1bgjA           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLR--------------
3cntB           --KVIIIGAGIAGLKAA--STLHIQDCLVLEADRVGGRL-------------------------------
3bi2A           --KVIIIGAGIAGLKAA--STLHIQDCLVLEADRVGGRL-------------------------------
1d4cA           ---VVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGN-------------------------------
1cj3A           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDEVLGRIRAGVLEQ---------------------
3cnpA           --KVIIIGAGIAGLKAA--STLHIQDCLVLEADRVGGRL-------------------------------
3cnsB           --KVIIIGAGIAGLKASTLHQNGIQDCLVLEADRVGGR--------------------------------
2dpoA           --DVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLI
2dkiA           -VDVLIVGCGPAGLTLAAQLAAFPDIRTCIVEQKEG----------------------------------
3bi4A           --KVIIIGAGIAGLKAA--STLHIQDCLVLEADRVGGRL-------------------------------
3bi4B           --KVIIIGAGIAGLKASTLHQNGIQDCLVLEADRVGG---------------------------------
3dl2B           VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEG---------------------------------
1cj4A           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILER--------------------------------------
3djeB           VTKLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVP---------------------------------
3bi2B           --KVIIIGAGIAGLKASTLHQNGIQDCLVLEADRVGG---------------------------------
2b9wA           -SRIAIIGAGPAGLAAGMYLEQAGFDYTILERDHVGG---------------------------------
1bgnA           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQG--------------------
1b73A           --KIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKD------------------------
3cirM           ---KVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGC--
3c4aA           --KILVIGAGPAGLVFASQLKQARPLWAIDIVEKNDE---------------------------------
3cnsA           --KVIIIGAGIAGLKASTLHQNGIQDCLVLEADRVGG---------------------------------
1c0iA           --RVVVLGSGVIGLSSALILARKGYSVHILARDLPEDVS-------------------------------
3bhfA           ---VIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPH---------------------------------
1e0dA           --NVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPE--------------------------
2czgB           ----------------------------------------------------------------------
1dobA           -TQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGV------------------------
2dwcA           ----------------------------------------------------------------------
1a48A           DWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTG---------------------------------
1auvB           ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAH--------------------------
2e37B           --KVGIVGSGVGATAYALALLGVAREVVLVDLD-------------------------------------
2aejB           --HVVICGWSESTLECLRELRGSEVFVLAEDEN-------------------------------------
1b3mA           ---VIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPH---------------------------------
2aefB           --HVVICGWSESTLECLRELRGSEVFVLAEDEN-------------------------------------
1dv1B           LDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY-----------
2ardA           --NIVIVGGGTAGWMAASYLVRALANITLIESAAIPRIGVGEATIPSLQ---------------------
3c96A           ---ILIAGAGIGGLSCALALQAGIGKVTLLESSPLGVGINIQPAAPALAATAIPTHELRYIDQSGATVWS
1do8A           --KILFLGAGEAALGIANLIVSVENGLSEQEAQKK-----------------------------------
1djnA           --VILNADTYFMAPSLAEKLATAGHEVTIVSG--------------------------------------
3bh1C           --KIRAISYEEDVLRLVDVFRDRGFLVEHVVL--------------------------------------
2drvA           --RSPILHVGAKTLEDAVKLVNLAVSCGFKYS--------------------------------------
2cyjA           --VLLVGTGIYGMLSLLPESKKLVEDKEVIEK--------------------------------------
2czgA           ----------------------------------------------------------------------
2dwcB           --KILLLGSGELGKEIAIEAQRLGVEVVAVDRY-------------------------------------
2czgB           --KILLLGSGELGKEIAIEAQRLGVEVVAVD---------------------------------------


                         .         .         *         .         .         .         .:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
1bhyA           AANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSLTAGDAYEQAA
1dxlA           VSNV------EIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDTTVVKGKHIII
1dncA           CEGKFNWRVIK-------EKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPTIEVSGKKYTAPHILI
3dk9A           CEGKFN-------WRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPTIEVSGKKYTAPHILI
1ebdA           ENVTIDFAKVQ-------EWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVSAQTYTFKNAII
2a8xA           GEVTFDYG-------IAYDRSRKVAEGRVAGVHFLKKNKITEIHGYGTFADANTLLVDGTESVTFDNAII
2bc0A           GAKVYMESPVQSIDYDAKTVTAL------VDGKNHVETYDKLIFATGSQPILPPIKG-------AEIKEG
2cfyA           EETVKHDWDRMIEAV--QNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFL
3eanC           EDTVKHDWEKMTESV------QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNKVYSAERFLI
2cduB           LGANVQMRHQVTN-----------------------------VDPETKTIKVKDLITNEEKTEAYDKLIM
3eanF           EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENA-YGKFIGPHKIMATNNKGKEKVYSAERFLI
2b76M           GFHMLHTLFQTSLQFPQIQRFDE--------------HFVLDILVDDGHVRGLVAMNMMEVQIRANAVVM
3eanD           EDTVKHDWEKMTESVQ-NHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLI
3eanA           EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEK-VYSAERFLI
3cgcA           YGIDAKVRHEVTK-----------------------------VDTEKKIVYAEHTKTKDVFEFSYDRLLI
1b37A           IVNS------TLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATSGRDDMSIL
2bc1A           LGAKVYMESPVQSIDYDAKTVTALVDGKNHVETYDKLIF------------ATGSQPILPPIKGAEIKEG
2cduA           LGANVQMRHQVTNVDPETKTIK-----------------------------VKDLITNEEKTEAYDKLIM
3cgbA           -------------------------FRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLI
2c75B           LGLETYKV---NEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGR---EIPSDAPWKAP
1b37B           IVNSTL------KLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATSGRDDMSIL
3cirA           GFHMLHTLFQTSLQFPQIQRF--------------DEHFVLDILVDDGHVRGLVAMNMMEVQIRANAVVM
3dh9A           HEAAAYGWNVDDKIKPDWHKHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFV
1d5tA           VDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKTETEALASNLMGMFEKRRFRKFLVF
2c72A           LGLETYKVNEVERLI------HHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAP
2bs2A           -------------------------ECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLDIIAYVAKGTLI
3dghB           ----------------------------------------------------------------------
3bg7A           VPVNTL-------VVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMSTHWRFDREQRPLL
2b76A           LHTLFQTSLQFPQIQR------------------FDEHFVLDILVDDGHVRGLVAMNMMEVQIRANAVVM
1d7yA           ------------------------------CKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVL
1bzlA           RESAGFGWFDRTTLRAEWKNLIAVKDEAVLNINKSYDEMFREFFLGWGSLESKNVVNVRESADPASAVKE
3coxA           MGFGINKSIDRYVLDSERFSGIKVYQGRGVGGGSLVNGMAVTPKRNYFEEILPSVDSNYFPRANTGLGVN
3d1cA           SPAFTFNEEHISGETYAEYLQVVANHY------------ELNIFENTVVTNISYTIATTTETYHADYIFV
3ctyB           ----VGSELAK-------------------LFADHAANYAKIREGVEVRSIKKTDIETNDDTYHAKYVII
3dghA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
2c76B           -KELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDM---GREIPSDAPWKAP
2e5vA           EEDLRLEGGHTKRRVLHRTDETGREIFNFL--LKLAREEGIPIIEDRLVEIRVKVTEKRGLVEDVDKLVL
2a87A           -------------------------------MREQALRFGADLRMEDVESVSLHGPLKDGQTHRARAVIL
2c73A           LGLETYKVNEV---ERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREI---PSDAPWKAP
3cp8A           ATGIQFRMLNRSKAQADKTQYSLYMRRIVEHEPNIDLLQDTVIGVSANSGKFSSVTVRSGRAIQAKAAIL
3cesD           IDQAGIQFRILNASKGPAVRATRRTALENQPNLMIFQQAVEDLIVENDRVVG--AVTQMGLKFRAKAVVL
2a87B           ----------------------ITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKDGQTHRARAVIL
2bk4B           --ELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKA---P
1aogB           ----------------------------------------------------------------------
3bg6A           VPVNTLVV-------DTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMSTHWTCATPRFDRE
1djnA           --------------------------------ETQITKLLKKNKESQLALGQKPMTADDVLQYGADKVII
3cesB           IDQAFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVEDVVGAVTQMGLKFRAKAVVL
1e6eC           GNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGTAVILGQGNVALDVARILL
3cpjG           IPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEW
2a0iA           ----------------------------------------------------------------------
3ef6A           ----------------------------------------------------------------------
1cl0A           FETEIIFDHINKVDLQNR----------------------------------PFRLNGDNGEYTCDALII
1coyA           MGFGINKSIDRYVLDSERFSGIKVYQGRGVGGGSLVNGMAVTPKRNYFEEILPSVDSNEMYNKYFPRANT
2bk4A           LGLETYKV---NEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREI---PSDAPWKAP
3ctyA           ---------------FKSIVGSELAK----LFADHAANYAKIREGVEVRSIKKTDIETNDDTYHAKYVII
2bi7A           VNKHAEMMPYVNRVKAT---------------------VNGQVFSLPINLHTINQFFSKTCSPDEARALI
3bh1C           --------------------------------------------EKYIEMQSQHIRERGGKLLEMGGKLF
2c72B           AKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGR---EIPSDAPWKAP
3blyA           PVNTLVVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMSTHWTCATPRFDREQRPLLVKD
2c76A           -KELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDM---GREIPSDAPWKAP
3cphG           IPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEW
3cpiG           DWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIEIEAISSPLMGIFEKRRMKKFLEW
3cesA           IDQAGIQFRILNASKGPAVRATRAQADRVLYRRTALENQPNLMIFQQAVEDLIVAVTQMGLKFRAKAVVL
3cpiH           ----------------------------------------------------------------------
2c75A           LGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFW------RTMDDMGREIPSDAPWKAP
1djqA           ---------------------------------------------NKESQLALGQKPMDVLQYGADKVII
3cp2A           IDQAGIQFRILNASKGPAVRATRAQADRVLYRQTALENQPNLMIFQQAIVENDRVVGAMGLKFRAKAVVL
3cetA           -----------------------------------------------------KITELHENGEFKVHHLV
3cphH           ----------------------------------------------------------------------
1e6eA           ----------------------------------------------------------------------
1az3B           ----------------------------------------------------------------------
1chuA           ----------------------------------------------------------------------
2bmaA           GGDPKGKS---------DNEILKFCQAFMNELYRHIGPCDVPAGDIGVGGREIGYLYGQYKKIVNSFNGT
1cjcA           ----------------------------------------------------------------------
2c73B           -KELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDM---GREIPSDAPWKAP
2ciqA           ---------------------------------------------------DKEVVLTHPADETTSVHIL
3d8xA           EQSTKFGTEIITETV-------------------------SKVDLSSKPFKLWTEFNEDAEPVTTDAIIL
3cetB           ---------------------------GGANTKITELHENGEFKVHHLYFPNDKLAEVLKTYSNDSHVAL
2dkhA           NDVTFW-KPDPGQPGRIARHGRVQDTEDGLSEFPHVILNQARVHDHYLERMRNSPSRLEPHYARRVLDVK
3b3rA           LWLDVVNRNIDPYADRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANS
2c7gA           ----------------------------------------------------------------------
2brxA           -----------------------------------------------------------------MRIVF
2drvA           --------------------------------KGEVDEDIIPLLKKINSIENYFTTSSCSGRIVEPHVNA
1cc6A           EGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQGERPYVFER
2cyjA           --------------------------------------------------IEEVRFGLDGKEFDHDIVIY
1bkwA           HEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQGERPYVTF
2culA           DPKDERVWAFHARAKYLLEGLRPL----------HLFQATATGLLLEGNRVVGVRTWEG-PPARGEKVVL
3datA           ---------------------------------------VKKTTMGHPLIMGRKNYEAIGRPLPGRRNII
2bmuB           -------------------------------------------------------------------IVF
3cukA           LLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYG----WFHTSLILE
3b6dA           DVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSSEMFPRANSMLRV
1b8sA           WLDVVNRNIDPYALDRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANS
3cesC           GLMAKAIDQAGIQFRILNASVRTALENQPNLM--IFQQAVEDLIVENDRVV--GAVTQMGLKFRAKAVVL
3e1tA           RGGTFRWG-KEPEPWTFGFTRHPDDPYGFAYQVERARFDDMLLRNSERKGVDVRERHEVIDVLFEGERAV
3dbhB           ----------------------------------------------------------------------
2bmuA           -------------------------------------------------------------------IVF
3d4oC           ----------------------------------------------------------------------
3dbrD           ----------------------------------------------------------------------
3cp8D           NRSKGPAMHSPRAQADKTQYSLYMRRIVEHEPNIDLLQDTVIGVSANSGKFSSVTVRSG-RAIQAKAAIL
3d4oA           DWNTVDAILLPISGTNEAGKVDTIFSNESIVLTEEIEKTPNHCVVYSGI------------SNTYLNQCK
2e4gB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3c4nA           GALGSGKTLEVEDRPLLHLLPAG------EGSGLTPTLDALADFPEALALLDPARLPV--ARVDPRALTY
1cboA           DVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANS
2apgA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
3cnjA           DVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANS
3dbhF           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
2czgA           INLDALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTK
1an9A           ----------------------------------------------------------------------
2bxrA           GTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEA
1cj2A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
1cc2A           DVVNRNIDPYAGVLDRVNYDQMSVYVGRGVGGGSLVNGMAVEPKRSYFEEILPRVDSDRYFPRANSMLRV
2bxsA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
3d4oB           DWNTVDAILLPISG---------TNEAGKVDTIFSNESIVLTEEIEKTPNHCVVYSSNTYLNQCKKTNRT
2apjA           AQAYLSN---------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3da1A           PIFKRYLNEKQTLEKEPLLRKENLKGGGIYVIKEAVARGAVALNYKVVGVVAKDRLTDTTHTIYAKKVVN
1bgjA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2dpoA           SSCTNLAEAVE-----------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
1auvB           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3c96A           EPRGVEAGNYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRLIGARDGHGKPQALGADVLVG
1do8A           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
1bhyA           PTGEKRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQG
1dxlA           ATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPT
1dncA           ATGGMPSTPHESQIPGSLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
3dk9A           ATGGMPSTPHESQIPGASLGITSDGFFQLELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1ebdA           ATGSRPIE-LPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSG
2a8xA           ATGSSTRLVPGTSLSANVVTYEEQILSREL-PKSIIIAGAGAIG-EFGYVLKNYGVDVTIVEFLPRALPN
2bc0A           SLEFEATLENLQFVKLYQNSADVIAKLENKDIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTLAGY
2cfyA           IATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYXXXXXXXXXXXXXXXXXXXXXXXL-LRG
3eanC           ATGERPRYLGIP-GDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2cduB           TTGSKPTVPPIPGIDSSRVYLCKNYNDEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVYKY
3eanF           ATGERPRYLGI-PGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2b76M           ATGGAGRVYRYNGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGEL
3eanD           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
3eanA           ATGERPRYLGIP-GDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLD-VTVMVRSILLRG
3cgcA           ATGVRPVMPEWEGRDLQGVHLLKTIPDETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTI
1b37A           AMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYY
2bc1A           SLEFEATLENLQFVKLYQNSADVIAKLENKDIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTLAGY
2cduA           TTGSKPTVPPIPGIDCKNYNDAKKLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHRVLYKY
3cgbA           ATGVREGRDLQGVHLLKTIPDAERILKTLETNKVVTIIGGGAIG-LEAETFVELGKKVRIERNDHIGTI-
2c75B           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
1b37B           AMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYY
3cirA           ATGGAGRV---------YRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGCRGEG
3dh9A           IAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIV-LRG
1d5tA           VANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINRIKLYSESL
2c72A           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
2bs2A           ATGGYGRIYGTGTAIALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPE
3dghB           ----------------------------------------------------------------------
3bg7A           VKADDAEWDRLYTKAESYFQTGTDQFKESIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWSSAN
2b76A           ATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMG
1d7yA           ATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSR
1bzlA           RLETEHILLASGSWPHMPNIPGIEHCISSNEAFYVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMI
3coxA           NIDQAWFESTEWYKFARTGRKTAQRSGFTTAFVPNVYDFEYMKKEAAGQVTKSGLGGEVIY----GNNAG
3d1cA           ATGDYNFPKKP---FKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDAAYQLAKNGSDIALYTSPSVRLSP
3ctyB           TTGTTHKHKGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCE
3dghA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
2c76B           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
2e5vA           ATGGYSYLYEYSSTQSTNIGDGMAIAFKAGTDMEFVQFHPTVTSLDGEVFLLTETLRGEGAQIINENGER
2a87A           AMGAAARYLQVQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRAS
2c73A           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQRK
3cp8A           ACGTFLNGLIHIGMDHFPGGRSTAEPPVEGLTESLASLGFSFGRLKTGTPPRIDSRSVDYTIVTECYLTK
3cesD           TVGTFLRELPLRVGRLKTGTPPRI-----DARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITH
2a87B           AMGAAARYLQVQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRAS
2bk4B           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIFSTTNGGQER
1aogB           ----------------------------------------------------------------------
3bg6A           QRPLLVKDEWDRLYTKAESYFQTGTDQFKESIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWSN
1djnA           ATGARWNTDGGADASLPDQLTPEQVMDGKKKIGKILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYM
3cesB           TVGTFLDIHIGSIPLSRRGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYITH
1e6eC           TPPDHLEWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATE
3cpjG           ISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSV
2a0iA           ----------------------------------------------------------------------
3ef6A           ----LPGSQLPGVVTLRTYGDVQVLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVR
1cl0A           ATGASARYLGLPSEEGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAE
1coyA           GLGVNNIDQAWFESTEWYKFAQRSGFTTAFVPNVYDFEYMKKEAAGQVTKSGLGGEVIY------GNNAG
2bk4A           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIFSTTNGGQER
3ctyA           TTGTTHKHLGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCE
2bi7A           AEKGDSTIADPQTFEEEALRFIGKELYEAFFKGYTIKQWGMQPSELPASILKRLPVRFNYDDNYFNHKFQ
3bh1C           DDMHASRVLPGFTPDNKIAMLDRIKDEVEILRHKIRAISYEEDVLRLVDVFRDRGFLVEHV-----VLTQ
2c72B           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
3blyA           DADADDA-EWDRLYTKAESYFQTGTDQFKESIRHNLVLNKLTEEYKGQRDFQQIPLARRSPTFVEWSSAN
2c76A           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
3cphG           ISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSV
3cpiG           ISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSV
3cesA           TVGTFLDGKIHIGSIPSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNCYITH
3cpiH           -SSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSV
2c75A           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
1djqA           ATGARWNTDGGADASLPDQLTPEQVMDGKKKIGKILNADTYFMAPSLAEKLATAGHEVTIVSGVHLANYM
3cp2A           TVGTFIRELPL------RVGRLK--------TGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHP
3cetA           SHVALVTTAETKKEGVDNI--LNAAESAFGSNISVFDSNGNFISLESAKTNN------KVSASNWCGTA-
3cphH           ----------------------------------------------------------------------
1e6eA           ----------------------------------------------------------------------
1az3B           ----------------------------------------------------------------------
1chuA           -----------------------------------------------------------------RFMPD
2bmaA           LTGKNVKWGGSNLRVEATGYGVLKSLNIPVEKQTAVVSGSGNVALYCVQKLLHLNVKVLTLSDSNGYVYE
1cjcA           ----------------------------------------------------------------------
2c73B           LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQER
2ciqA           KYGATVYSWKLKSEEQLWLSTAAKLDGSKPVGIPLVFPVFGKNSTDEHLSKLPQHGLARNLGQTKENPPT
3d8xA           ATGASAKRMHLPGEETYWQKGISACAVCDGANKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRAS
3cetB           VTTAELADSYETKKEGVDNILNAAE-SAFGSNISVFDSNGNFISLESAKTNN-------------KVSAS
2dkhA           VDHGAADYPVTVTLERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDSANQAWGVMDVLAVTD
3b3rA           MLRVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVDFGYMQREAAGEVPKSALATEVIYGNNHG
2c7gA           ----------------------------------------------------------------------
2brxA           DIGGSVLVPENPDIDFIKEIA-YQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITR
2drvA           KWLGKWHREVS--LYEVLEAIKKHRSGQLWFLVRSPILHVGAKTLEDAVKLVNLAVSCGFKYSNIKSILI
1cc6A           DGERLRLDCDYIAGCDGFHGISSQSIPAERLKVFERVYPFGWLG-------------------LLADTPP
2cyjA           PSGRIERRMKEISKKKHGTSHKLDPEELEKYFDVLLVGTGIYGMLSLLPESKKLVEDKEVIEKPTKALKL
1bkwA           ERDGERLRLDCDYI---------------------AGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLA
2culA           AVGSFLGA-RLFLGGVVEEAGRLSEASYPDLLEDLSRLG-FRFVEREGEVPPGYRVRYLAFHPEEWEEKT
3datA           VTRNEGYHVEGC----EVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYTKIHHAFEGDTFFPE
2bmuB           DIGGSVLVPENPDIDFIKEIA-YQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITR
3cukA           GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM
3b6dA           NHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYDFGYMQREAAGEVPKSALATEVIYGNNHGK--
1b8sA           MLRVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYFGYMQREAAGEVPKSALATEVIYGNNHG
3cesC           TVGTFLDGK-------------------------------------------------------------
3e1tA           GVRYRNTEGVELMAHARFIVDASGNRTRVSQAVGERVYSRFFQNVALYGYFENGKRLPAPRQGNILSAAF
3dbhB           --DWEGRWNHVLERSGPFTHPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVS
2bmuA           DIGGSVLVPENPDIDFIKEIA-YQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITR
3d4oC           ----------------------------------------------------------------------
3dbrD           ---------------------STESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVS
3cp8D           ACGTFLNHFPGGRSTAE-----------------------------------------------------
3d4oA           KTNRTLVKLERDDIAIYNSIPTAEGTIAIQIHGANVAVLGLGRVGSVARKFAALGAKVKVGARESDLLAR
2e4gB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3c4nA           RPGSLANTRAELVPGGVRLHRLTVVHETRQIRAGVIIVAAGAAGPALVEQGLGLHTRHGRAYRQFPRLDL
1cboA           MLRVIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVVYDFGYMQREAAGEVPKSALATEVIYGNNHGKQS
2apgA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
3cnjA           MLRVNHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYDFGYMQREAAGEVPKSALATEVIYGNNH
3dbhF           --DWEGRWNHVLERSGPFTHPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVS
1d4cB           ----------------------------------------------------------------------
2czgA           AIM-------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2bxrA           QHADKWDKMTMK--ELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVGQER
1cj2A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
1cc2A           NHIDTKWFEDTEWYKFARVSREQAGKAGLGTVFVPNVYDFGYMQREAAGEVPKSALATEVIYGNNHGKQS
2bxsA           ----------------------------------------------------------------------
2dwcB           --------------------RDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAM
1d4cC           ----------------------------------------------------------------------
3d4oB           LVKLERDDIAIYNSIPTAEGTIAIQHTDFTIHGANVAVLGLGRVGSVARKFAALGAKVKVGARESDLL--
2apjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3da1A           AAGPWVDTLREKDRSKHGKYLKLSKGVHLVVD--------------------------------------
1bgjA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2czgB           --------------------------ATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAM
1dobA           ----------------------------------------------------------------------
2dwcA           -----------------IKLRDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAM
1a48A           ----------------------------------------------------------------------
1auvB           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3c96A           ADGIHSAHPDQRPLSHGGITMWRGVTEFDRFL--------------------------------------
1do8A           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgA           -------------------------------AQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAM
2dwcB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
1bhyA           ADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFAPKEPQRYDAVLVAAGRAPNGKLISAEKAG
1dxlA           MDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEPQTIIEADVVLVSAGRTPFTSGLNLDKIG
1dncA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVIPDVDCLLWAIGRVPNTKDLSLNKLG
3dk9A           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLERLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLG
1ebdA           FEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIG
2a8xA           EDADVSKEIEKQFKKLGVTILTATKVESIADGGSQVTVTVTKAQELKAEKVLQAIGFAPNVEGYGLDKAG
2bc0A           YDRDLTDLMAKNMEEHGIQLAFGETVKEVAGNGKVE-KIITDKNEYDVDMVILAVGFRPNTTLG---NGK
2cfyA           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGNSEEIIEGEYNTVMLAIGRDACTRKIGLETVG
3eanC           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTIEDEFNTVLLAVGRDSCTRTIGLETVG
2cduB           FDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGKEIKSDIAILCIGFRPNTELLKG---K
3eanF           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRSEETIEDEFNTVLLAVGRDSCTRTIGLETVG
2b76M           GPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKE--PIPVRP
3eanD           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTIEDEFNTVLLAVGRDSCTRTIGLETVG
3eanA           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLEETIEDEFNTVLLAVGRDSCTRTIGLETVG
3cgcA           YDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVE-AVETDKGTYKADLVLVSVGVKPNTDFL--EGTN
1b37A           LAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPK
2bc1A           YDRDLTDLMAKNMEEHGIQLAFGETVKEVAGNGKVE-KIITDKNEYDVDMVILAVGFRPNTTLG---NGK
2cduA           FDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGKEIKSDIAILCIGFRPNTELLKG---K
3cgbA           -YDGDAEYIYKEADKHHIEILTNENVKAFKGNERVEAV-ETDKGTYKADLVLVSVGVKPNTD--FLEGTN
2c75B           KFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
1b37B           LAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPK
3cirA           GIRDKVSQAFWHEWRKGNTISTPRGYLDLRHLGEKKL---HERLPFICELAKAYVGVDPVKE--PIPVRP
3dh9A           FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYEESEDVYDTVLWAIGRKGLVDDLNLPNAG
1d5tA           ARGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAGQVIR
2c72A           KFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETNHEMYEAKYVISAIPPTLGMKIHFNPPLP
2bs2A           KKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISKHIETNLRDVQEICEYFAGIDPAEK--WAPVLP
3dghB           ---------------------------------------TGEESEDVYDTVLWAIGRKGLVDDLNLPNAG
3bg7A           TVFDLQNRPNTDAPEERFNLFPAVACERVVRNALNSEIESGDRFEIKADVYVLTAGAVHNTQLLVNSGFG
2b76A           PETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRLHERLPFICELAKAYVGVDPVKE--PIPVRP
1d7yA           APATLADFVARYHAAQGVDLRFERSVTGSVDGV----VLLDDGTRIAADMVVVGIGVLANDALA--RAAG
1bzlA           LRGFDHTELTKQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNA
3coxA           KKSLDKTYLAQAAATGKLTITTLHRVTKVAPATGSGYSVTMATKVVTADRVFFAAGSVGTSKLLVSMKAQ
3d1cA           YTRQRLGNVIKQGARIENVHYTVKDIDFNNGQYHI--SFDSGQSVHTPHEPILATGFDATKNP--IVQQL
3ctyB           NAYVQEIKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTS--FLKDSG
3dghA           -------------------------------------------SEDVYDTVLWAIGRKGLVDDLNLPNAG
1aogA           -----------------------------------------SGKKMDFDLVMMAIGRSPRTKDLQLQNAG
2c76B           KFGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
2e5vA           FLFNYDKRGELAPRDILSRAIYIEMLKGHKVFIDLSKIEDFERKFPVVAKYLARHGHNYKV---KIPIFP
2a87A           KIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSG--LVREAI
2c73A           FVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEASAIPPTLGMKIHFNPPLPMMRN
3cp8A           TTEKTHDILRTGFDRSPLFTGCPSIEDKISRFPDKSSHHIFLEPEGTDTVEMYVNGIAGLRSIPGLEEAK
3cesD           TNEKTHDVIRSNLSIEDKVMRNQHQIFLEPEGLTSNEIGISTSLPFDVQMQIVRSMQGMENAKIVRPGYA
2a87B           KIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSG--LVREAI
2bk4B           KFVGGGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
1aogB           -------------------------------------VTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
3bg6A           TVFDLQNRPNTDAPEERFNLFPAVACERVVRNALNSEIESGDRFEIKADVYVLTAGAVHNTQLLVNSGFG
1djnA           HFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDSKRTYRGPGVSPRDANTSHRWIEFDSLV
3cesB           TNEKTHDVIRSNLSIEDKVMRFADRNQHQIFLEPEGLTPNGISTSLPFDVQMQIVRSMQGMAKIVRPGYA
1e6eC           WGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATPTGDVEDLPCGLVLSSIGYKSRPIDPSVPF--
3cpjG           ARYGKSPYLYPLSAIYGGTYMLDTPIDEVLYKKDTGKFVKTKLGTFKAPLVIADPTYFPEKCKSTGQR--
2a0iA           -----MSIAQVRSAGSAGNFYTDVLGSGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQDG
3ef6A           VGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQLEQVMASDGRSFVADSALICVGAEPADQLAR----Q
1cl0A           KILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLEL
1coyA           KKSLDKTYLAQAAATGKLTITTLHRVTKVAPATGSGYSVTMATKVVTADRVFFAAGSVGTSKLLVSMKAQ
2bk4A           FVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
3ctyA           NAYVQEIKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTS--FLKDSG
2bi7A           GKCGYTQMIKSILNHENIKVDLQREFIVEERTHYDHV--------------FYSGPLDAFYGYQYGRLGY
3bh1C           NDNRLALAFIERLQRLGIKVSRHRVIPGYPTDMDRIVSDEGFGLNEYAETTRDLVVVTAPGPG-------
2c72B           KVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
3blyA           TVFDLQNRPNTDAPEERFNLFPAVACERVVRNALNSEIISGDRFEIKADVYVLTAGAVHNTQLLVNSGFG
2c76A           KVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
3cphG           ALGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTFEGVKTKLGTFKAPLVIADPTYFPEKCKSTGQR--
3cpiG           ALGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKLGTFKAPLVIADPTYFPEKCKST----G
3cesA           TNEKTHDVIRSNLDRSPSIEDKVMRFADRNQHQIFLIYPNGISTSLPFDVQMQIVRSMQGMENIVRPGYA
3cpiH           ARYGKSPYFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGTKLGTFKAPLVIADPTYFPEKCKSTGQR--
2c75A           KFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLETLNHEMYEAKYVISAIPPTLGMKIHFNPPLP
1djqA           HFTLEYPNMMRRLHELHVEELGDHFCSRIEPGRMEIYNIWGDGSKRTYDSLVLVTGRHSECTL-------
3cp2A           QQVPCYITHTNDRNQHQIFLEPEGLTSNEIYPNGISTS-------LPFDVQMQIVRSMQGMENAKIVRPG
3cetA           ------KWVSKNIEENCILVDGSTTTDIIPIVEGKVVAEKTDLERLNHELLYVGTLRTPISHLGNTIS--
3cphH           -------------------------------------GVKTKLGTFKAPLVIADPTYFPEKCKST----G
1e6eA           WGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFD-
1az3B           -----------------------------------------------------------SLRSDLINALY
1chuA           FDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPI--VP
2bmaA           PNGFTHENLEFLIDLKEEKK--GRIKEYLNHSSTAKYFPNEKPWGVPCTLAFPCATQNDVD-LDQAKLLQ
1cjcA           WGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPF--
2c73B           KFVGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHAKYVISAIPPTLGMKIHFNPPLPMMRN
2ciqA           VQFGLKPEIANPELTKLWPMDYLLILTVELGSDYLKVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLA
3d8xA           TIMQKRAEKNEKIEILYNTVLEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQ--V
3cetB           NWCGTAKWVSKNIEENCILVDGSTTTDIIPIVEGKVVAEKTDLERLNHELLYVGTLRTPISHLGN----T
2dkhA           FPDVRYKVAIQSEQGNVLIIPREGGHLVRFYVEMDNITVEQIATAQRVLHPYKLEVKNVPWWSVYEIGQR
3b3rA           KQSLDKTYLAAALGTGKVTIQTLHQVKTIRQTKDGGYAKLLATKEISCRYLFLGAGSLGSTELLVRARDT
2c7gA           ----------------------GRNELVSDGSGRVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPF---
2brxA           ANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIP--VMGGTHPGHTTDAVAALLAEFLKADLLVVNVDG
2drvA           RDVLLGENGEIFVGEEYLNKIVEIANDQRRFKEKLKRLE-------------------------------
1cc6A           VSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKS
2cyjA           LEELWGKKRILAI---------------------------------------------------------
1bkwA           DTHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKLVTGPSLEKS
2culA           FRLKRLEGLYAVGLCVREGDYARMSEEGKRLA--------------------------------------
3datA           MDMTNWKEVFVEKGLTDEKNPYTYYYHVYEK---------------------------------------
2bmuB           ANALLIAALR----EKAYPVVVEDFWEAWKAVQLKKIPVGGTHPGHTTDAVAALLAEFLKADLLVV----
3cukA           KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNT-IWEGCCRLEPTLKNARIIGER
3b6dA           -QSLDKTYLAAALGTGKVTIQTLHQVKTIRQTKDGLTVEQKDTKEISCRYLFLGAGSLGSTELLVRARDT
1b8sA           KQSLDKTYLAAALGTGKVTIQTLHQVKTIRQTKDGLTVEQKDTKEISCRYLFLGAGSLGSTELLVRARDT
3cesC           ----------------------------------------------------------------------
3e1tA           QDGWFWYIPLSDTLTSVGAVVSREAAEAIKDGH----------EAALLRYIDRCPIIKEYLAPATYGEIR
3dbhB           NLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWING
2bmuA           ANALLIAALREKAYPVVVED--------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dbrD           NLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWING
3cp8D           ----------------------------------------------------------------------
3d4oA           IAEGEPFHISKAAQELRDVDVCINTIPALVVTANVLAEPSHTFVIDLASKPGGTDFRYAEKRGIKALLVP
2e4gB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3c4nA           LSGAQTPVLRASGLTLRPQNGGYTLVPAIHHRDPHGYHPAGGSLTGVPTGLRRELLEDLVGLDAVPALAG
1cboA           LDKTYLA---AALGTGKVTIQTLHQVKTIRQTKDGGYAKLLATKEISCRYLFLGAGSLGSTELLVRARDT
2apgA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
3cnjA           GKQSLDKTLAAALGTGKVTIQTLHQVKTIRQTKDGGTVEQKDTDGKLLATKEISCRYLFLGAGS------
3dbhF           NLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFDFNDTFYRQFHIIVCGLDSIIARRWI----NG
1d4cB           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2bxrA           KFVGGGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIP--------------
1cj2A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
1cc2A           L---DKTYLAAALGTGKVTIQTLHQVKTIRQTKDGGYAKLLATKEISCRYLFLGAGSLGSTELLVRARDT
2bxsA           ----------------------------------------------------------------------
2dwcB           QVAHR-----------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
2apjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3da1A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2czgB           Q---------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
2dwcA           QVAH------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
1auvB           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1do8A           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgA           Q---------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
1bhyA           VAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPG-VAYTSP
1dxlA           VETDKLGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEYLAGKVGHVDYDKV-PGVVYTNP
1dncA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYEDSKLDYNNIPTVVFSHP
3dk9A           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYEDSKLDYNNIPTVVFSHP
1ebdA           IKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVA-IPAVVFSDP
2a8xA           VALTDRKAI-GVDDYRTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRLPRATFCQP
2bc0A           IDLFRNGAFLVNKRQETSIPGVYAIGDCATIYALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGL
2cfyA           VKINEKTKIPVTDEEQTNVPYIYAIGDILEDKELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
3eanC           VKINEKTKIPVTDEEQTNVPYIYAIGDILGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
2cduB           VAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGR
3eanF           VKINEKTKIPVTDEEQTNVPYIYAIGDILGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
2b76M           TAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNE
3eanD           VKINEKTGKIPVTDEQTNVPYIYAIGDILGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
3eanA           VKINEKGKIPVTDEEQTNVPYIYAIGDILEGLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
3cgcA           IRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNL
1b37A           LPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYVWQEFEKQYPDANVLLVTVTDEE
2bc1A           IDLFRNGAFLVNKRQETSIPGVYAIGDCATIYALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGL
2cduA           VAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGR
3cgbA           IRTNHKGAI-EVNAYQTNVQDVYAAGDCATHYHIGTTANKQGRLAGLNLDKRR--AFKGTLGTGIIKFNL
2c75B           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTK-PEGNYAAIMGFILAHK
1b37B           LPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRYYGVWQEFEKQYPDANVLLVTVTDEE
3cirA           TAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNE
3dh9A           V-TVQKDKIPVDSQEATNVANIYAVGDIIGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPL
1d5tA           IICILSHPIKNTND-ANSCQIIIPQNQVNRKSDIYVCMISYAHKYIAIASTDPEKEVEPALGLLEPIDQK
2c72A           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYT-LDDTKPEGNYAAIMGFILAHK
2bs2A           MQHYSMGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAIVGEYFAEHCANTQVDLETK
3dghB           V-TVQKDKIPVDSQEATNVANIYAVGDIIGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPL
3bg7A           QLPNPANPPELLGSYITEQSLVFCQTVMSTELIDSVKSDMTIRGTPGELTYSV-TYTPGASTNKHPDWWN
2b76A           TAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNE
1d7yA           LACDDG--IFVDAYGRTTCPDVYALGDVTRQRETWSNAQNQGIAVARHLVDPTAPGYAELPWYWSDQGAL
1bzlA           GVMIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
3coxA           GH-LPNLSSQVGEGWGNNGNIMVGRANHMWDATGSKQATIPTMGIDNWADPTAPIFAEIAPLPAGLETYV
3d1cA           FVTTNQDIKLTTHDESTRYPNIFIGATVENDNCYIYKFRARFAVLAHLLTQREGLPAKQEVIENKNQYLD
3ctyB           VKLDERGYIVVDSRQRTSVPGVYAAGDVTGNFAQIASAVGDGCKAALSLYS-------------------
3dghA           V-TVQKDKIPVDSQEATNVANIYAVGDIIGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPL
1aogA           V-MIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
2c76B           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTK-PEGNYAAIMGFILAHK
2e5vA           AAHFVDGGIRVNIRGESNIVNLYAIGEVSDSNRLASNSLLEGLVFGINLPRYVDSSWEGISTDDGIVHSV
2a87A           DVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTY-------------------------------------
2c73A           QMITRVP---LGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKP--EGNYAAIMGFILAHK
3cp8A           MIRPFHPWQIRSTMETRPVENLFFAGQINGT-SGYEEAAAQGLMAGINAVRKI-------LGKELIVLGR
3cesD           IEYDFFDPRDLKPTLEKFIQGLFFAGQINGTTWAPARSAYLGVLVDDLCTLGTKEPYRMFTSRAEYMLRE
2a87B           DVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTY-------------------------------------
2bk4B           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEE-APVAYTLDDTKPEGNYAAIMGFILAHK
1aogB           V-MIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
3bg6A           QLGNPANPPELLPSLGSEQSLVFCQTVMSTELIDSVKSDMTIRGTPGELTY-SVTYTPGASTNKHPDWWN
1djnA           LTLWNELKARESEWAENDIKGIYLIGDAEAP-RLIADATFTGHRVAREIEEANPQI-------AIPYKRE
3cesB           IEYDFFDPRDLKPTLEKFIQGLFFAGQINGTT-GYEEAAAQGLLA---GLNAA----RLSADKEGWAPAR
1e6eC           --DPKLGVVPNMEGRVVDVPGLYCSGWVKRGTGVITTTMTDSFLTGQILLQDL--------KAGHLPSGP
3cpjG           --VIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSTDKPHIELEPAFKLLGPIE
2a0iA           SNRH-RPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTR-VTVLTGNLVMALFNHD
3ef6A           AGLACDRGVIVDHCGATLAKGVFAVGDVASWPLRAGGRRSLETYMNAQRQAAAVASAPQLPVSWTEIAGH
1cl0A           ENGYKVQSGIHGNATQTSIPGVFAAGDVMDHIYQAITSAGTGCMAALDAER-------------------
1coyA           G-HLPNLSSQVGEGWGNNGNIMVGRANHMWDATGSKQATIPTMGIDNWADPTAPIF-AEIAPLPAGLETY
2bk4A           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGT-MIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHK
3ctyA           VKLDERGYIVVDSRQRTSVPGVYAAGDVTGNFAQIASAVGDGCKAALSLYSDSIS---------------
2bi7A           RTLDFKKFTYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSRAC-EENDIPYYPIRQMGEM
3bh1C           --SGKLATCLSQVYHEHKRGVAAGYAKFETFPIWNLPLEHPVNLAYEA----------------------
2c72B           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYT-LDDTKPEGNYAAIMGFILAHK
3blyA           QLPNPANPPELLGSYITEQSLVFCQTVMSTELIDSVKSDMTIRGTPGELTYSVTYTPGASTN-KHPDWWN
2c76A           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGT-MIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHK
3cphG           --VIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSK-------GHYLAIISTII
3cpiG           QRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHLAIISTIIETDKPHIE
3cesA           IEYDFFDPRDLKPTLEKFIQGLFFAGQINGTTG-YEEAAAQGLLA---GLNAA----RLSADKEGWAPAR
3cpiH           --VIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHY--------LAIISTI
2c75A           MMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYT-LDDTKPEGNYAAIMGFILAHK
1djqA           ---WNELKARESEWAENDIKGIYLIGDAEAP-RLIADATFTGHRVAREIEEANPQI-------AIPYKRE
3cp2A           YAIEYDPRDLKPTLESKFIQGLFFAGQINGTTWAPARSQAYLGVLVDDLCTGTKEPYRMFTAEYRLMLRE
3cetA           --FKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTD-KRSSLVRISKVLCSDLDQISEIDAE
3cphH           QRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGYLAIISTIIETDKPHIE
1e6eA           ---PKLGVVPNMEGRVVDVPGLYCSGWVKRGPGVITTTMTDSFLTGQILLQDLKA--------GHLPSGP
1az3B           DEDV-CGIISAEGKIYPLG-----SDKVLSTIFELFSRPIINKIAEKHGYIVE-EPKQQNHYPDFTLYKP
1chuA           AAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSLLECLVYG-WSAAEDITRRMHDISTLP
2bmaA           KNGCILVGEGANMPSTVDAINLFKSNNIIYCPSKAANAGGVAISGNFQFSHWTRETVDEKLKEIMRNIFI
1cjcA           --DPKLGVVPNMEGRVVDVPGLYCSGWVKRGTGVITTTMTDSFLTGQILLQD--------LKAGHLPSGP
2c73B           QMITRVPLGSVIKCIVYYKEPFW----RKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMG-FILAHK
2ciqA           ---GMKLYDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDT--VVWNPW
3d8xA           DTDEAGYIKTVPGSSLTSVPGFFAAGDVQSKYRQAITSAGSGCMAALDAEK-------------------
3cetB           ISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSS----------------------
2dkhA           ICAKYDDVVDAVATPDSPLPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLSSE
3b3rA           GTLPNLN---------------------------------------------------------------
2c7gA           --DDQSGTIPNVGGRINGSPNEYVVGWIKGPTGVIGTNKKDAQDTVDTLIKNL-GNAKEGAECKSFDHAD
2brxA           V---------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cc6A           IAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKA------------------
2cyjA           ----------------------------------------------------------------------
1bkwA           IAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKA------------------
2culA           ----------------------------------------------------------------------
3datA           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3cukA           TGFRPVRPQIRLEREQLNTEVIHNYGHGGGLTI----HWGCALEAAKLFGRI------------------
3b6dA           GTLP-NLNSEVGAGWGPNGNIMTARAN-------------------------------------------
1b8sA           GTL-------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
3e1tA           IRKDYSYCNTSFWKNGMALVGDAACFVDPVFSSGVHLATYSALLVARAINTC------------------
3dbhB           MLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNAAVILPGMTACIECTLELYPPQVNFPMATIAS--MPRL
2bmuA           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dbrD           MLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNAQVILPGMTACIECTLELYPPQVNFPMATIASMPRLPE
3cp8D           ----------------------------------------------------------------------
3d4oA           GLPGIVAPKTAGRILADVLVKLLA----------------------------------------------
2e4gB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3c4nA           EGL-------------------------------------------------------------------
1cboA           GTLPNLN-SEVGAGWGPNGNIMT-----------------------------------------------
2apgA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3dbhF           MLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNAAVILPGMTACIECTLEL--------------------
1d4cB           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
1cc2A           GTLPNLN-SEVGAGWGPNGNIMTARANH------------------------------------------
2bxsA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
2apjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3da1A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
1auvB           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1do8A           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
1bhyA           EVAWVGETELSAKASARKITKANFPWAASGRAIANGCDKPFTKLIFDAETGRIIGGGIVGPNGGDMIGEV
1dxlA           EVASVGKTEEQVKETGVEYRVGKFPFMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAPNAGELIHEA
1dncA           PIGTVGLTEDEAIYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
3dk9A           PIGTVGLTEDEAIHKYGIVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
1ebdA           ECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAEL
2a8xA           NVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELLPEL
2bc0A           HMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREDVMGIHMF
2cfyA           EYGACGLSEEKAVEKFGEENIEVYHSYFWPTIPSRDNNKCYAKIICTKDNERVVGFHVLGPNAGEVTQGF
3eanC           EYGCCGLSEEKAVEKFGEEVYHSFFWPLEWTVPSRDNNKCYAKVICLKDNERVVGFHVLGPNAGEVTQGF
2cduB           TYVSTGINTALAKANNLKVSEVIIADNYRPEFMLSTDE-VLMSLVYDPKTRVILGGALSSHDVSQSANVL
3eanF           EYGCCGLSEEKAVEKFGEEVYHSFFWPLEWTVPSRDNNKCYAKVICNLKNERVVGFHVLGPNAGEVTQGF
2b76M           AAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAM---EEGCGIYRTPELMQKTIDKLAELQERFKRV
3eanD           EYGCCGLSEEKAVEKFGEEVYHSFFWPLEWTVPSRDNNKCYAKVICLKDNERVVGFHVLGPNAGEVTQGF
3eanA           EYGCCGLSEEKAVEKFGEEVYHSFFWPLEWTVPSRDNNKCYAKVICLKDNERVVGFHVLGPNAGEVTQGF
3cgcA           TLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAK-PLYLKLLYRSDTKQLLGGQVIGEEGVKRIDVI
1b37A           SRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDA--------TDILVPRWWSDRFYKGTFSNWPVGVNRYEY
2bc1A           HMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREDVMGIHMF
2cduA           TYVSTGINTALAKANNLKVSEVIIADNYRPEFMLSTDE-VLMSLVYDPKTRVILGGALSSHDVSQSANVL
3cgbA           TLARTGLNEKEAKGLHIP--YKTVKVDSTNAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDV
2c75B           ARKLARLTKEERLKKLCELYAKVLGSLEALEP----VHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
1b37B           SRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATD--------ILVPRWWSDRFYKGTFSNWPVGVNRYEY
3cirA           AAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLA--MEEGCGIYRTPELMQKTIDKLA-ELQERFKRV
3dh9A           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFQKSVRYCYLKAVARHGDQRVYGLHYIGPVAGEVIQGF
1d5tA           FVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNIKDIYKRM--------------------------
2c72A           ARKLARLTKEERLKKLCELYAKVLG----SLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
2bs2A           TLEKFVKGQEAYMKSLVESKGTEDVFKIKN---RMKDVMDDNVGIFRDGPHLEKAVKELE-ELYKKSKNV
3dghB           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFQKSVRYCYLKAVARHGDQRVYGLHYIGPVAGEVIQGF
3bg7A           EKVKNHMMQHQEDPLPIPFEDPEPQVTTLFQPSHPWHTQIHRFSYGAVQQSIDSRLIVDWRFFGRTEPKE
2b76A           AAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAM---EEGCGIYRTPELMQKTIDKLAELQERFKRV
1d7yA           RIQVAGLASGDEEIVRGEVSL-----------------DAPKFTLIELQKGRIVGATCVNNARDFAPLRR
1bzlA           PIGTCGLIEEVASKRYEVVAVYLSSFTPLMHKVSGSKYKTVAKIITNHSDGTVLGVHLLGDNAPEIIQGI
3coxA           SLYLAITKNPERARFQFNSGTGKVDLTWAQSQNQK-----------------------------------
3d1cA           DYSCCEVSCT------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3dghA           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFQKSVRYCYLKAVARHGDQRVYGLHYIGPVAGEVIQGF
1aogA           PIGTCGLIEEVASKRYEVVAVYLSSFTPLMHKVSGSKYKTVAKIITNHSDGTVLGVHLLGDNAPEIIQGI
2c76B           ARKLARLTKEERLKKLCELYAKVLGSLEALEP----VHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
2e5vA           RISGNKTLSLKEI-RRINWENVGIIRNEEKLV------KAINTYSSSTQNEAIISYLTALAAEIRK----
2a87A           ----------------------------------------------------------------------
2c73A           ARKLARLTKEERLKKLCELYAKVLGSLEALE----PVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
3cp8A           DQAYIGVLIDDLITKETKEPYRMFTSSAEHRLILRHDNADLRLRKIGYDCNLVSSDDLHRTESIIKRV--
3cesD           DNADLRLTEIGRELGLVDDE--RWARFNEKLENIERERQRLKSTWPSAEAAAEVNAHLTAPLSS------
2a87B           ----------------------------------------------------------------------
2bk4B           ARKLARLTKEERLKKLCELYAKVLG----SLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
1aogB           PIGTCGLIEEVASKRYEVVAVYLSSFTPLMHKVSGSKYKTVAKIITNHSDGTVLGVHLLGDNAPEIIQGI
3bg6A           EKVKNHMMQHQEDPLPIPFEDPEPQVTTLFQPSHPWHTQIHRDAFSYGAVQQSIDSRLIVDWRFFGRTEP
1djnA           TIAWGTPHM-------------------------------------------------------------
3cesB           SQAYLGVLVDDLCT--------------------------------------------------------
1e6eC           RPGSAFIKALLDSRG-VWPVSFSDWEKLDAEEVSRGQASGREKLLDPQEMLRLLG---------------
3cpjG           EKFMGIAELFEPRDGSKDNIYLSRYDASSHFESMTDDVKDIYFRVTGHPL--------------------
2a0iA           TSRDQEPQLHHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEALGYETEVVGKHGMWEMP
3ef6A           RMQMAGDIEGPGD------------------FVSRGMPGSGAALLFRLQERRIQAVVAVDAPRDFALATR
1cl0A           ----------------------------------------------------------------------
1coyA           VSLYLAITKNPERARFQFNSGTGKVDLTWAQSQNQKGIDMAKKVFDKIN---------------------
2bk4A           ARKLARLTKEERLKKLCELYAKVLGSLEALEPV----HYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
3ctyA           ----------------------------------------------------------------------
2bi7A           ALLEKYLSLAENETNITFGRLGTYRYLDMDVTIAEA--LKTAEVYLNSLTENQPMPVFTVS---------
3bh1C           ----------------------------------------------------------------------
2c72B           ARKLARLTKEERLKKLCELYAKVLGSLEALEPV----HYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
3blyA           EKVKNHMMQHQEDPLPIPFEDPEPQVTTLFQPSHPWHTQIHRDAFSYGAVQQSIDSRLIVDWRFFGRTEP
2c76A           ARKLARLTKEERLKKLCELYAKVLG----SLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
3cphG           ETDKPHIELEPAFKLLGPIEEKFMGIAELFPREDGSKDNIYLSRSYDASSHFDIYFRVTGHPL-------
3cpiG           LEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYYDASSHFESMTDDVKDIYVTGHPLVL----------
3cesA           SQAYLGVLVDDLCT--------------------------------------------------------
3cpiH           IETDKPHIELEPAFKLLGPIEEKFMGIAELFEPDGSKDNIYLSRSYDASSHFESMTDDVKDIYFRVT---
2c75A           ARKLARLTKEERLKKLCELYAKVLGSLEALEP----VHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
1djqA           TIAWGTPHM-------------------------------------------------------------
3cp2A           DNADLRLTEIGRELGLVD--DERWARFNEKLENIERERQRLTWVTPSAEAAAEVNAHLTAPLSREASGE-
3cetA           NIAKNYYELWK---ELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSF
3cphH           LEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYYDASSHFESMTDDVKDFRVTGHPLV-----------
1e6eA           RPGSAFIKALLDSRG-VWPVSFSDWEKLDAEEVSRGQASGREKLLDPQEMLRLLG---------------
1az3B           SEPNKKIAID------------IKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVY
1chuA           PWDESRVENPDVVIQHNWHELRLFMWDYVGIVRTKRLERALRRITMLQQEIEYYAHFRVSNNLLELRNLV
2bmaA           ACSENALKYTKN---KYDLQAGANIAGFLKVAESYIEQ--------------------------------
1cjcA           RPGSAFIKALLDSRG-VWPVSFSDWEKLDAEEVSRGQASGREKLLDPQEMLRLLG---------------
2c73B           ARKLARLTKEERLKKLCELYAKVLG----SLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVL
2ciqA           IEKSQGMADFEPKTGYICIEPGHVHDFISLAP---GKKWNAYQLLCK-----------------------
3d8xA           ----------------------------------------------------------------------
3cetB           ----------------------------------------------------------------------
2dkhA           RQVVAQQLIDFDREWAKDPKEFQKYFEQHGRFTAGVGTHYAPSLLTGQAKHQALASGF------------
3b3rA           ----------------------------------------------------------------------
2c7gA           QVADWLAAR------QPKLVTSAHWQVIDAFERAAGEPHGRPRVKLASLAELLRI---------------
2brxA           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
3datA           ----------------------------------------------------------------------
2bmuB           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
3b6dA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3cesC           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
3dbhB           PEHCIEYVRMFGEGVPLDGKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATVFKIATSA
2bmuA           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dbrD           HCIEYVRMLQWPKEQPEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAV
3cp8D           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
1cboA           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3dbhF           ----------------------------------------------------------------------
1d4cB           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
2apjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3da1A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cirM           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
1c0iA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
2dwcA           ----------------------------------------------------------------------
1a48A           ----------------------------------------------------------------------
1auvB           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1dv1B           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
1do8A           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
2czgB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGFPE
1bhyA           YLAIEMGCDAADIGKTIHPHPTLGESIGMAAEVAL-----
1dxlA           AIALQYDASSEDIARVCHAHPTMSEAIKEAAMATY-----
1dncA           AVAVKMGATKADFDNTVAIHPTSSEELV------------
3dk9A           AVAVKMGATKADFDNTVAIHPTSSEELVT-----------
1ebdA           GLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVAL-----
2a8xA           TLAQRWDLTASELARNVHTHPTSE-ALQECFHGLV-----
2bc0A           SLAIQEGVTIEKLALTIFFLPHFNKPYNYITMAALG----
2cfyA           AAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSG---
3eanC           AAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSG---
2cduB           SVCIQNKNTIDDLAMVMLFQPQFDRPFNYLNILGQAA---
3eanF           AAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSG---
2b76M           RITDTSSVFNTDLLYTIELGLNVAECMAHSA---------
3eanD           AAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSG---
3eanA           AAALKCGLTKQQLDSTIGIHPVCAEIFTTLSVTKRSG---
3cgcA           AMALFNKMSIHDLEDVDLSYNSVWDPIQQAAR--------
1b37A           DQLRAPVGRVYFTGEHTSENGYVHGAYLSGID--------
2bc1A           SLAIQEGVTIEKLALTIFFLPHFNKPYNYITMAALG----
2cduA           SVCIQNKNTIDDLAMVMLFQPQFDRPFNYLNILGQAA---
3cgbA           IAALFNKSIHDLEDVDLSPYNSVWDPIQQAAR--------
2c75B           RQPVDRIYFAGTETA-----THWSGLMEGAVEA-------
1b37B           DQLRAPVGRVYFTGEHTSENGYVHGAYLSGID--------
3cirA           RITDTSSVFNTDLLYTIELGHGLNVAMAHSA---------
3dh9A           AAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSG---
1d5tA           ----------------------------------------
2c72A           RQPVDRIYFAGTETA-----THWSGHMEGAVEA-------
2bs2A           GIKNKRLHANPELEEAYRVPMML-----------------
3dghB           AAALKSGLTINTLINTVGIHPTTAEEFTRLA---------
3bg7A           ENKLWFSDKITDAYNMPQPTF-------------------
2b76A           RITDTSSVFNTDLLYTIELGHGLNVAMAHSA---------
1d7yA           LLAVGAKPDRAALADP---ATDLR----------------
1bzlA           GICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSY-----
3coxA           ----------------------------------------
3d1cA           ----------------------------------------
3ctyB           ----------------------------------------
3dghA           AAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSG---
1aogA           GICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSYYY---
2c76B           RQPVDRIYFAGT--ETATHWSGMEGAVERAAREILH----
2e5vA           ----------------------------------------
2a87A           ----------------------------------------
2c73A           RQPVDRIYFAGTETA-----THWSGFMEGAVEA-------
3cp8A           ----------------------------------------
3cesD           ----------------------------------------
2a87B           ----------------------------------------
2bk4B           RQPVDRIYFAGT--ETATHWSGMEGAVEAGERA-------
1aogB           GICLKLNAKISDFYNTIGVHPTSAEELCSMRT--------
3bg6A           KEENKLWFSDKITDAYNMPQ--------------------
1djnA           ----------------------------------------
3cesB           ----------------------------------------
1e6eC           ----------------------------------------
3cpjG           ----------------------------------------
2a0iA           GVPVEAFSGSQTIREAVGEDASLKSRDVAALD--------
3ef6A           LVEARAAIEPARLADL---SNSMR----------------
1cl0A           ----------------------------------------
1coyA           ----------------------------------------
2bk4A           RQPVDRIYFAGTETA-----THWSGYMEGAVEA-------
3ctyA           ----------------------------------------
2bi7A           ----------------------------------------
3bh1C           ----------------------------------------
2c72B           RQPVDRIYFAGTETA-----THWSGHMEGAVEA-------
3blyA           KEENKLWFSDKITDAYNMPQPTFDFRFPAGRTSKEAEDMM
2c76A           RQPVDRIYFAG--TETATHWSGMEGAVERAAREILH----
3cphG           ----------------------------------------
3cpiG           ----------------------------------------
3cesA           ----------------------------------------
3cpiH           ----------------------------------------
2c75A           RQPVDRIYFAGTETA-----THWSGLMEGAVEA-------
1djqA           ----------------------------------------
3cp2A           ----------------------------------------
3cetA           AVAELLKNELLE----------------------------
3cphH           ----------------------------------------
1e6eA           ----------------------------------------
1az3B           TRVKTYNI--NELNEIPKPYKGVKVFLQDKWVIA------
1chuA           QVAELIVRCAMMGLHFTLDYPELLTHSGPSI---------
2bmaA           ----------------------------------------
1cjcA           ----------------------------------------
2c73B           RQPVDRIYFAGTETA-----THWSGFMEGAVEA-------
2ciqA           ----------------------------------------
3d8xA           ----------------------------------------
3cetB           ----------------------------------------
2dkhA           ----------------------------------------
3b3rA           ----------------------------------------
2c7gA           ----------------------------------------
2brxA           ----------------------------------------
2drvA           ----------------------------------------
1cc6A           ----------------------------------------
2cyjA           ----------------------------------------
1bkwA           ----------------------------------------
2culA           ----------------------------------------
3datA           ----------------------------------------
2bmuB           ----------------------------------------
3cukA           ----------------------------------------
3b6dA           ----------------------------------------
1b8sA           ----------------------------------------
3cesC           ----------------------------------------
3e1tA           ----------------------------------------
3dbhB           YIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQ
2bmuA           ----------------------------------------
3d4oC           ----------------------------------------
3dbrD           IAAVCATEVFKIATSA---YIPLNNYLVFNDVDGLYTYT-
3cp8D           ----------------------------------------
3d4oA           ----------------------------------------
2e4gB           ----------------------------------------
2e4gA           ----------------------------------------
3c4nA           ----------------------------------------
1cboA           ----------------------------------------
2apgA           ----------------------------------------
1cc4A           ----------------------------------------
2du8A           ----------------------------------------
3cnjA           ----------------------------------------
3dbhF           ----------------------------------------
1d4cB           ----------------------------------------
2czgA           ----------------------------------------
1an9A           ----------------------------------------
2bxrA           ----------------------------------------
1cj2A           ----------------------------------------
1d4dA           ----------------------------------------
1cc2A           ----------------------------------------
2bxsA           ----------------------------------------
2dwcB           ----------------------------------------
1d4cC           ----------------------------------------
3d4oB           ----------------------------------------
2apjA           ----------------------------------------
3cgvA           ----------------------------------------
1d7lA           ----------------------------------------
3da1A           ----------------------------------------
1bgjA           ----------------------------------------
3cntB           ----------------------------------------
3bi2A           ----------------------------------------
1d4cA           ----------------------------------------
1cj3A           ----------------------------------------
3cnpA           ----------------------------------------
3cnsB           ----------------------------------------
2dpoA           ----------------------------------------
2dkiA           ----------------------------------------
3bi4A           ----------------------------------------
3bi4B           ----------------------------------------
3dl2B           ----------------------------------------
1cj4A           ----------------------------------------
3djeB           ----------------------------------------
3bi2B           ----------------------------------------
2b9wA           ----------------------------------------
1bgnA           ----------------------------------------
1b73A           ----------------------------------------
3cirM           ----------------------------------------
3c4aA           ----------------------------------------
3cnsA           ----------------------------------------
1c0iA           ----------------------------------------
3bhfA           ----------------------------------------
1e0dA           ----------------------------------------
2czgB           ----------------------------------------
1dobA           ----------------------------------------
2dwcA           ----------------------------------------
1a48A           ----------------------------------------
1auvB           ----------------------------------------
2e37B           ----------------------------------------
2aejB           ----------------------------------------
1b3mA           ----------------------------------------
2aefB           ----------------------------------------
1dv1B           ----------------------------------------
2ardA           ----------------------------------------
3c96A           ----------------------------------------
1do8A           ----------------------------------------
1djnA           ----------------------------------------
3bh1C           ----------------------------------------
2drvA           ----------------------------------------
2cyjA           ----------------------------------------
2czgA           ----------------------------------------
2dwcB           ----------------------------------------
2czgB           ----------------------------------------