[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56646.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbnI.bssp"
#ERROR : Can't open dsspfile "2axoA.bssp"

## Summary of PDB Search
:169
    6e-26  38%  3bbnI  [x.x.x] RIBOSOMAL PROTEIN S9
    1e-06  10%  2axoA  [x.x.x] HYPOTHETICAL PROTEIN ATU2684
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGTGXXXXXXXXXXXXPGTGEWKING
3bbnI           ---------------------------------------------GTGRRKCAIARVVLQEGTGKFIINY
2axoA           -----------------------------------------------------------------AILNG


                         .         .         *         .         .         .         .:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
3bbnI           RDAKEYLQNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSAS-HRAPLKQE
2axoA           RDHVKGADVRGIYD-RLDAFKREGQGLNVPVSSKFAGDEVEIDIGAGNGKADVVVAYFTREQ-TVDVKK-


                         +         .         .         .         .         *         .:210
query           GFLTRDARKVEXXXXXXXXXXXXPQYSKR
3bbnI           GLLTRDSRIVERKKPGLKKARKAPQFSKR
2axoA           ---SYWHSVYD------------------