[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56713.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bl4B.bssp"

## Summary of PDB Search
:248
    1e-15   9%  3bl4B  [x.x.x] UNCHARACTERIZED PROTEIN
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGAEVTEQDLRVP
3bl4B           ------LTWPRGAAITAADAERALRVNQLCGDDRHPLVDATTADVSRGARAVFGRPCQASRIALLGPVDR


                         .         .         *         .         .         .         .:140
query           FSKKMIKDSPRFETGGHLSPEQEAQLYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bl4B           VLANFFLGINAVPCPTKFFTSERDALT-------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bl4B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bl4B           --------------------------------------