[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ56815.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c58A.bssp"
#ERROR : Can't open dsspfile "1eaqB.bssp"
#ERROR : Can't open dsspfile "1eaqA.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "2chgB.bssp"

## Summary of PDB Search
:390
    4e-20  12%  3c58A  [x.x.x] DNA GLYCOSYLASE
    8e-12   8%  1eaqB  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    3e-09   5%  1eaqA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    3e-07  34%  1a5tA  [x.x.x] DELTA PRIME
    4e-04  19%  2chgB  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHAWLFTGPPXXXXXXXXXXXXXXLQCTHGGCGE
3c58A           -------------------------------------------------------------------ETV
1eaqB           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1a5tA           -------------------------------------HALLIQALPGMGDDALIYALSRYLLCQHKSCGH
2chgB           --------------------------------------------------------------GTGKTATA


                         .         .         *         .         .         .         .:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
3c58A           RRELEKRIVGQKIISIEATPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRHLRMEGKYRLAT
1eaqB           -------------------------SVEVLADHPGELVRTD-SPNFLSSVLPTHWRSNKTLPIAFKVVAL
1eaqA           --------------------------VEVLADHPGELVRTDSPNF--LSSVLPTHWRSNKTLPIAFKVVA
1a5tA           CRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLE
2chgB           IALARDLFGENWRDNFIEMNASDERGIDVVRHKIKEFARTIGGAPFKIIFLDEADALTADAQAALRRTME


                         +         .         .         .         .         *         .:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIIDALxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           LDAPHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLK------------------------------
1eaqB           GDVPDGTLVTVAGNDAELRNATAAKNQVARFNDLRFVGRSGRG---------------------------
1eaqA           LGDVDGTLVTVAGNDAELRNATAAKNQVARFNDLRFVGRSGRG---------------------------
1a5tA           EPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWL---------------------------
2chgB           MYSKSCRFILSCNYVSRIIEPIQSRCAVFRFKPVPKEAMKKRL---------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           ----------------------------------------------------------------------
1eaqB           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           ----------------------------------------------------------------------
1eaqB           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           ----------------------------------------
1eaqB           ----------------------------------------
1eaqA           ----------------------------------------
1a5tA           ----------------------------------------
2chgB           ----------------------------------------