[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for tfus0:AAZ57003.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "1d6eC.bssp"
#ERROR : Can't open dsspfile "2bp7B.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "3c38A.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "2bfcB.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "2csiA.bssp"
#ERROR : Can't open dsspfile "1dtwB.bssp"

## Summary of PDB Search
:792
    6e-43  15%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    5e-37  18%  2e6kA  [x.x.x] TRANSKETOLASE
    3e-33  11%  1d6eC  [b.40.2 - d.15.6] PROTEIN (ENTEROTOXIN TYPE B)
    3e-28   9%  2bp7B  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    5e-17  13%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-16  14%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-16  14%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-15   8%  3c38A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    3e-15  12%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-14  12%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-14  12%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-14  14%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-13  16%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    1e-12  13%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    7e-12  12%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-10  13%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-10  13%  2bfcB  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE BETA SUBUNIT
    3e-10  13%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-10  12%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    4e-09  14%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    2e-07  12%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-07  18%  2csiA  [x.x.x] RIM BINDING PROTEIN 2
    3e-07  13%  1dtwB  [c.36.1 - c.48.1] BRANCHED-CHAIN ALPHA-KETO ACID
:792

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
1ay0A           -------------------------------------------------DTVSKANSGHPGAPLGMAPAA
2e6kA           -------------------------------------------------DAVEKARSGHPGPGAPLAYLL
1d6eC           -----------FGANYYYQCYFSKKRKTCMYGGVTEHNGNQLDKYRRVFEDGKNLLSFDVQTNTAQELDY
2bp7B           ----------------------------------------------------------------------
2beuA           ----------------------------------------------------------FYMTNYGEEGTH
2bfdA           -------------------------------------------MDRILYESQRQGRISFYMTNYGEEGTH
2bfbA           -------------------------------------------------ESQRQGRISFYMTNYGEEGTH
3c38A           -------------------------------ALRIHQDSTAKNASLINALVSRDSRLDEFFSSVDELELS
2bp7A           -------------------------------LRQGMRAMLKTRIDSRMVVAQRQKKMSFYMQSLGEEAIG
3dv0E           -------------------------------------------------SLNRQGRLGFYAPTAGQEASQ
2bffA           -------------------------------------------MDRILYESQRQGRISFYMTNYGEEGTH
3dvaA           -----------LSDEQLKELMRRMVYTRIL--------------DQRSISLNRQGRLGFYAPTAGQEASQ
1dtwA           -------------------------------------------MDRILYESQRQGRISFYMTNYGEEGTH
2bfcA           -------------------------------------------MDRILYESQRQGRISFYMTNYGEEGTH
3dv0C           -------------------------------------------------SLNRQGRLGFYAPTAGQEASQ
3dv0A           -----------LSDEQLKELMRRMVYTRILDQRSISLN--------------RQGRLGFYAPTAGQEASQ
2bfcB           ----------------------------------------------------------------------
3dv0G           --------MPELSDEQLKELMRRMVYTRIL--------------DQRSISLNRQGRLGFYAPTAGQEASQ
3dvaE           -------------------------------------------------SLNRQGRLGFYAPTAGQEASQ
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------MDRILYESQRQGRISFYMTNYGEE
2csiA           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
1ay0A           HVLWSQMRMNPTNPDWINRDRFVLSNGHAVALL-----YSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEF
2e6kA           FRENPLDPDWPDRDRFVLSAGHGSLLYAVLHLTGYDL--PLEELKSFRQWGSKTP---------GHPERG
1d6eC           LTRHYLVKNKKL-YEFNNSPYETGY--IKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSDVKI
2bp7B           ----------------------------------------------------------------------
2beuA           VGSAAALDNT---DLVFGQYREAGVLMYRDYPLELFMAQ-----------CYGNISDLGKGRQMPVHYGC
2bfdA           VGSAAALDNTD---LVFGQAREAGVLMYRDYPLELFMAQ-----------CYGNISDLGKGRQMPVHYGC
2bfbA           VGSAAALDNTDL---VFGAYREAGVLMYRDYPLELFMAQCY-----------GNISDLGKGRQMPVHYGC
3c38A           NAPDLRFISSHDNILW--DDGNASFYGIAQQELNKLIRRVAISGNWHLVQTEGKSVHILMRRSSLIEAGG
2bp7A           SGQALALNRT--DMCFPTYRQQSILMARD-VSLVEMICQLLSNERDPLKGRQ-------LPIMYSVREAG
3dv0E           IASHFALEKE----DFILPGYRDVPQIIWHGLPL-----------------YQAFLFSRGHFHGNQIGVN
2bffA           VGSAAALDNT----DLVFGQYREAGVLMYRDY----------PLELFMAQCYGNISDLGKGRQMPVHYGC
3dvaA           IASHFALEKED----FILPGYRDVPQIIWHGLP-----------------LYQAFLFSRGHFHGNQIGVN
1dtwA           VGSAAALDNT---DLVFGQYREAGVLMYRDYPLELFMAQCY-----------GNISDLGKGRQMPVHYGC
2bfcA           VGSAAALDNTDL---VFGQFREAGVLMYRDYPLELFMAQCY-----------GNISDLGKGRQMPVHYGC
3dv0C           IASHFALEKE----DFILPGYRDVPQIIWHGLPL-------------YQAFL--FSRGHFHGNQIPEGVN
3dv0A           IASHFALEKE--DFILPGYRDVPQ------IIWHGLPLY---------QAFLFSRGHFHGNQIPEGV--N
2bfcB           ----------------------------------------------------------------------
3dv0G           IASHFALEKE--DFILPGYRDVPQI------IWHGLPLYQAFL-----------FSRGHFHGNQIPEGVN
3dvaE           IASHFALEKE-----DFILPGYRDVPQI---IWHGLP-------------LYQAFLFSRGHFHGNQIGVN
3ea4A           -------------------------------PPQYAIKVLDELTDGKAIISTGVGQHQMWAAQFYNYKKP
2bfeA           GTHVGSAAALDNTDLVFGAAREAGVLMYRDYPLELFMAQCY-----------GNISDLGKGRQMPVHYGC
2csiA           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLXXXXXXXXXXXXXXXLSGSWQSIRFLNPARDGAVLPILHLN
1ay0A           ELPGVEVTTGPLGQGISNAVGMAYNKPGFTLSDNYTYVFLGDGCLQISSEASSLAGHLKLGNLIAIYDDN
2e6kA           HTPGVEVTTGPLGQGISTAVGLALKLAAEFNRPGHVVVDHYTYVLASSGEAASLAGHWGLSKLIVFWDDN
1d6eC           E---------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2beuA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
2bfdA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
2bfbA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
3c38A           QVVGYLYVGIVLNDNFALLENIRSGSNSENLVLAVDTTPLVSTLKGNEPYSLDYVVHSAKDADSFIVGQT
2bp7A           FFTISGNLATQFVQAVGWAMASAIKGDTKIASAWIGDGATAE----SDFHTALTFAHVYRAPVILNVVNN
3dv0E           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFK----APAIFVVQNN
2bffA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
3dvaA           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFK----APAIFVVQNN
1dtwA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
2bfcA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
3dv0C           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGA----FKAPAIFVVQNN
3dv0A           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGA----FKAPAIFVVQNN
2bfcB           ----------------------------------------------------------------------
3dv0G           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGA----FKAPAIFVVQNN
3dvaE           VLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGA----FKAPAIFVVQNN
3ea4A           RQWLSSGGLGAMGFGLPAAIGASVANPDADGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRF
2bfeA           KERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN
2csiA           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
1ay0A           KITIDGAT--SISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKA------------IAQAKLSKDK---
2e6kA           RISIDGPT--DLAFTEDVLARYRAYGWQTLVEDVNDLEALRKAIKLAKLDE-------------------
1d6eC           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2beuA           GYAISTPTSEQYRGD-GIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEARIGHHSTS
2bfdA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIG--
2bfbA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPF------------
3c38A           FLEVESVP--------------------------------------------------------------
2bp7A           QWAISTFQAIAGGESTTFAGRGVGCGIASLRVDGNDFVAVYERARRGLGPSLIEWVTYRAGPHST-SDDP
3dv0E           RFAISTPVEKQT-VAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIET-LCFRYEW
2bffA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHH
3dvaA           RFAASTPVEKQT-VAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARE-----------RAINGEGPT-
1dtwA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAEAMTYRIGHHSTSDDSS
2bfcA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAEAMTYRIDHPISRLRHY
3dv0C           RFAISTPVEKQT-VAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETL------C
3dv0A           RFAISTPVEKQT-VAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGTLCFRYGPHENEWAKK
2bfcB           ----------------------------------------------------------------------
3dv0G           RFAISTPV-EKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGTLCFRYGPHTDPTNEW
3dvaE           RFAASTPVEKQT-VAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGTLCFRYGPHTMGDNEW
3ea4A           YKANRAHTFLGDPAQPNMLLFAAACGIPAARVTKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSG
2bfeA           GYAISTPTSEQY-RGDGIAARGPGYGIMSIRVDGNDVFAVYNATARRRAVAENQPFLIEAMTYRIGHSTD
2csiA           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
1ay0A           ---PTLIKMTTTIGYGSLHAGSHSVAGAPLKADDV------KQLKSKFGFNPDKSFVVPQEVYDHYQKTI
2e6kA           --RPTLIAVRSHIGFGSPKQDSAKAHGEPLGPEAVEATRRNLGPEEVRHDREKGRAWQEAKALEAYARAY
1d6eC           ----------------------------------------------------------------------
2bp7B           ----------------------------------------------------------------------
2beuA           DDSSAYRNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNLLFS------
2bfdA           STDHPISRLRHYLLSQGWKQSRRKVMEAFEQAERKPKPNPNLLFSDQESLARHLQTYGPLDHFD------
2bfbA           -----LIEAMTYRDHPISRLRHYLLSQGWWDEEQEWRKQSRRKVMEAFEQAERKPKPNPNLLFSD-----
3c38A           ----------------------------------------------------------------------
2bp7A           SKYRPADDWSHFPLGDPIARLKQHLIKIGHWSEEEHQATTAEFEAAVIAAQKE-----AEQYGTLANGHI
3dv0E           AKKDPLVRFRKFKGLWSEEEENNEAIKKADETPKQKVTDLEELPFNLKEQYEIYKEK-------------
2bffA           STSDDSSAYREVQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNLLFSDVYQEM
3dvaA           -----LIETLCFRYGPHTMSGDDP-----TRYRSKELENEWAKKDPLVRFRKFLEALWSEEEENN-----
1dtwA           AYRHPISRLRHYLLSQGRKQSRRKVMEAFEQAERKPKPNPNEMPAQLRKQQESLARHLQT----------
2bfcA           LLSQGWWDEEQEKAW--RKQSRRKVMEAFEQAERKP------KPNPNLLFSDVYQEMPAQKQQESLARHL
3dv0C           FRYGPHTENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQTDLISI-----
3dv0A           DPLVRFRKFLEAKGLWSEEEENDETPKQKVTDLIS--IMFEELPFNLKEQYEIYKEK-------------
2bfcB           ----------------------------------------------------------------------
3dv0G           AKKDPLVRFREAKGLWSEEEEN------------------------------------------------
3dvaE           AKKDPLVRFREAKGLWSEEEEN------------------------------------------------
3ea4A           GTFNDVITEGDGR---------------------------------------------------------
2bfeA           HPISRLRHYLLSQGWWDEEQEKAWRKQSRR---KVMEAFEQAERKPKPNPNLLFSDVYQEMP--------
2csiA           ----------------------------------------------------------------------
1dtwB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PEXXXXXXXXDCRISSSPHANGGXXXXXXXXPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF
1ay0A           LKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSEVYNQLPEL
2e6kA           PDLHQELRRLRGELPPLPE----------------------EPPSFDKPIATRAASGRALNLLAPRLPEL
1d6eC           ----------------------------------------------------------------------
2bp7B           ---------------------------------------------------IQALRSAMDVMLERDD-NV
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           PS--------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           PA--------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           QT--------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           ---------------------------------------------------FQSVTSALDNSLAKDP-TA
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           ----------------------------------------------------------------------
1dtwB           ---------------------------------------------------FQSVTSALDNSLAKDPT-A


                         .         .         +         .         .         .         .:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
1ay0A           IGGSADLTPSNLTRWKEALDFQPPSSGSG------NYSGRYIRYIREHAMGAIMNGISAFGAN-----YK
2e6kA           LGGSADLTPSNNTKAEGEDFSRAN------------PLGRYLHFVREHAGAILNGLNLHGGYRAYGGTFL
1d6eC           ----------------------------------------------------------------------
2bp7B           VVYGQDVGYFGGVFRCTEGLQTKY------------GKSRVFDAISESGIVGTAVGMGAYGLRPVVEIQF
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           VIFGEDVAFGGV-------------FRCTVGLRDKYGKDRVFNTLCEQGIVGFGIGIAVTGATAIAEIFA
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           ---GSSGSSGRRMVALYDYDPRESSPNVDVEAELTFCTGDIITVF-GEIDEDGFYYGELNGQKGLVPS--
1dtwB           VIFGEDVAFGGV-------------FRCTVGLRDKYGKDRVFNTLCEQGIVGFGIGIAVTGATAIAEIFA


                         *         .         .         .         .         +         .:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
1ay0A           PYGGTFLNFVSYAAGAVRLSALSGHPV-----IWVATHDSIGVGEDGPTHQPIE--TLAHFRSLPNIQVW
2e6kA           VFSD----------------YRPAIRLAALGVPFVFTHDSIALGEDGPTHQPVEHLSLRAPN----LFVI
1d6eC           ----------------------------------------------------------------------
2bp7B           AYFYPASDQIVSEMARL------RYRSAGEFIAPLTLRMPCGGGIYGGQTHSQSPEAMFTQVCG--LRTV
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           DYIFPAFDQIVNEAAKYRYRSGDLFN-----CGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPG--IKVV
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           NFLEEVSG--------------------------------------------------------------
1dtwB           DYIFPAFDQIVNEAAKYRYRSGDLFN-----CGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPG--IKVV


                         .         .         .         *         .         .         .:630
query           LPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
1ay0A           RPADGNEVSAAYKNSLESKHTPSIIALSRQN-LPQLEGSSIESASKGGYVLQDVA------NPDIILVAT
2e6kA           RPADAYETFYAWLVALRRKEGPTALVLTRQA-VPLLSPEKARGLLRGGYVLEDV------EEPQGVLVAT
1d6eC           ----------------------------------------------------------------------
2bp7B           MPSNPYDAKGLLIASIECDDPVIFLEPKRLYNGPFDGHHDRPVTPWSKHPHSAVPDGYYRPGNDVSVLTY
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           IPRSPFQAKGLLLSCIEDKNPC-IFFEPKIL-YRAAAEEVPIEPYNIPLSQAEVIQEG----SDVTLVAW
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           ----------------------------------------------------------------------
1dtwB           IPRSPFQAKGLLLSCIEDKNPCIFFEP--KILYRAAAEEVPIEPYNIPLSQAEVIQEG----SDVTLVAW


                         .         +         .         .         .         .         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVDLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWL
1ay0A           GSEVS-LSVEAAKTLAAK--NIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYA--
2e6kA           GSEVH-LALRAQALLREKGVR-----VRVVSLPSFELFAAQP----EAYRKEVLPPGLPVVAVEAGASLG
1d6eC           ----------------------------------------------------------------------
2bp7B           G-TTVYVAQVAAEESGVDAEVIDLRSLWPLDLDTIVESVKTGRCVVVHEATRTCGFGAELVSLVQEHCFH
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           GTQVH-VIREVASMAKEKL-GVSCEVIDLRTIIPWDVDTICKSVIKTGRL--LISHEAPLTGGFASEISS
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           ----------------------------------------------------------------------
1dtwB           G-TQVHVIREVASMAKEKL-GVSCEVIDLRTIIPW--DVDTICKSVIKTGRLLISHEAPLTGGFASE--I


                         .         .         .         .         +         .         .:770
query           IHRLTYRRAGHPNLHVRGYKEEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDxxxx
1ay0A           ----------HQSFGIDRFGASG---KAPEVFKFFGFTPEGVAERAQKTIAFYK--GDKLISPLKK----
2e6kA           WERYAHKV-----VALDRF---GASAPYPEVYERLGFTPERVAEAFLSLV--------------------
1d6eC           ----------------------------------------------------------------------
2bp7B           HLEAPIERVTGWD-----------TPYPHAQEWAYFPGPSRVGAALKKVME-------------------
2beuA           ----------------------------------------------------------------------
2bfdA           ----------------------------------------------------------------------
2bfbA           ----------------------------------------------------------------------
3c38A           ----------------------------------------------------------------------
2bp7A           ----------------------------------------------------------------------
3dv0E           ----------------------------------------------------------------------
2bffA           ----------------------------------------------------------------------
3dvaA           ----------------------------------------------------------------------
1dtwA           ----------------------------------------------------------------------
2bfcA           ----------------------------------------------------------------------
3dv0C           ----------------------------------------------------------------------
3dv0A           ----------------------------------------------------------------------
2bfcB           TVQEECFLNLEAPISRVCGYDTP---FPHIFEPFYIPDKWKCYDALRKMI--------------------
3dv0G           ----------------------------------------------------------------------
3dvaE           ----------------------------------------------------------------------
3ea4A           ----------------------------------------------------------------------
2bfeA           ----------------------------------------------------------------------
2csiA           ----------------------------------------------------------------------
1dtwB           SSTVQEECFLNLEAPIS-RVCGYDTPFPHIFEPFYIPDKWKCYDALRKMI--------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxx
1ay0A           ----------------------
2e6kA           ----------------------
1d6eC           ----------------------
2bp7B           ----------------------
2beuA           ----------------------
2bfdA           ----------------------
2bfbA           ----------------------
3c38A           ----------------------
2bp7A           ----------------------
3dv0E           ----------------------
2bffA           ----------------------
3dvaA           ----------------------
1dtwA           ----------------------
2bfcA           ----------------------
3dv0C           ----------------------
3dv0A           ----------------------
2bfcB           ----------------------
3dv0G           ----------------------
3dvaE           ----------------------
3ea4A           ----------------------
2bfeA           ----------------------
2csiA           ----------------------
1dtwB           ----------------------