[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54134.1

[Show Plain Result]


## Summary of Sequence Search
    1::267
    1::273     1e-43  50%  274 aa  PF02567 PhzC-PhzF "Phenazine biosynthesis-like protein"
    1::267

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
PF02567         ------VDAFTDEPFGGNPAAVVLDADGLSDEQMQAIAREFNLSETAFVLPPTDPDADYRLRIFTPTGEV


                         .         .         *         .         .         .         .:140
query           DLCXXXXXXXXXXXXXXXXXXPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
PF02567         PFCGHATLATAHALLERGGLGGGRFETKAGLLPVRGDDGLLELDFPRFRPTPVDAEEALLAALGGLPIQV


                         +         .         .         .         .         *         .:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
PF02567         VSTGLPDLLVPLKSEEALLALRPDFAALAALGGRGVIVFAAAAAGAEADFVSRMFAPAVGIPEDPVTGSA


                         .         .         .         +         .         .         .:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSExxxxx
PF02567         HAALAPYLAEKLGRYTLEQGQASGRPGRLRVEVDGGEDERVRIGGTAVTVME-----