[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54138.1

[Show Plain Result]


## Summary of Sequence Search
    1::777
    1::193     2e-52  64%  193 aa  PF09371 Tex_N "Tex-like protein N-terminal domain"
    1::777

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIXXXXXXXXXXXXXXT
PF09371         --------IAEELNIRPKQVRAAVELLDEGNTVPFIARYRKEATGGLDDVQLRNLEERLTYLRELEERRE


                         .         .         *         .         .         .         .:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
PF09371         TILKSIEEQGKLTPELRAAIEAADTKTELEDLYLPYKPKRRTKATIAREAGLEPLADLLLAQPTADPEEE


                         +         .         .         .         .         *         .:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGxxxxxxxxx
PF09371         AAAYVNEEKGVADVEAALDGARDILAERIAEDAELRGKLREYLWKNGVLSSKVKKGKEEGG---------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09371         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxx
PF09371         -------