[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54205.1

[Show Plain Result]


## Summary of Sequence Search
    1::262
    1::215     6e-55  45%  219 aa  PF08889 WbqC "WbqC-like protein family"
    1::262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQPHYLPWLGLLDKIDRCDLFVVLDHVQFERKGWQHRN
PF08889         ---------------------------------QPYYLPWIGYFDLIAAVDKFVIYDDVQYQKQGWRNRN


                         .         .         *         .         .         .         .:140
query           YVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWE
PF08889         RIKTPNGPQWLTVPVKKGSRNQLIKDVRIDDDQNWRKKHWKTL-ESAYRKAPYFEEYEPLLEPLYEKKYT


                         +         .         .         .         .         *         .:210
query           QLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRY
PF08889         FLSDLNLELLELICEYLGIDTPIVRSSELDLPEGKKTERLLDICKKLGATTYLSGPGGRDYLDEELFEAN


                         .         .         .         +         .         .         .:280
query           GIAVEWQNFQHPEYPQHNRKGQEFLPRMAAIDLLLNVGPEGMxxxxxxxxxx
PF08889         GIELEFQDYRHPEYPQ---LGGGFVPNLSILDLLFNCGPEAL----------