[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54436.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
    2::254     2e-38  37%  255 aa  PF01026 TatD_DNase "TatD related DNase"
  243::293     0.001  36%  339 aa  PF01208 URO-D "Uroporphyrinogen decarboxylase (URO-D)"
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
PF01026         ---------------------------------DTHCHLDDPDEDLDEVLARAAEAGVTKLLVTGTSLED
PF01208         ----------------------------------------------------------TPLLETGADVVG


                         .         .         *         .         .         .         .:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCA
PF01026         SERALELAEEYNRVYATVGVHPWFAAEDTEELLEK---------------------LEELAELKHPKVVA
PF01208         LDWTVDLAEAARRLGGKVALQGNLDPSVLYGTPEE-----------------------------------


                         +         .         .         .         .         *         .:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
PF01026         IGEIGLDYDRRDFSPKEHQKEVFEAQLELAKELGLPVFLHTRDAHDDFLEILKEYGAPGAGVLHSFTGSL
PF01208         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRAL
PF01026         EEAKQLLDLGFYISFSGCITFKNAEELREVVKAIPLDRLLLETDAPYLAPVPYRGKRNEPAYVPYVAEKL
PF01208         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AELKGMAEDELAETVAANARRAFxxx
PF01026         AELKGISLEEVAEITTENARRLF---
PF01208         --------------------------