[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54462.1

[Show Plain Result]


## Summary of Sequence Search
    1::1210
    3::99      8e-20  52%  100 aa  PF02559 CarD_TRCF "CarD-like/TRCF domain"
    1::81      4e-18  44%  101 aa  PF03461 TRCF "TRCF domain"
   16::167     5e-07  34%  167 aa  PF00270 DEAD "DEAD/DEAH box helicase"
    7::76      7e-06  34%   76 aa  PF00271 Helicase_C "Helicase conserved C-terminal domain"
    4::35      8e-04  56%  410 aa  PF01432 Peptidase_M3 "Peptidase family M3"
    1::1210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPGDYVVHEQHGIGRYVEMVSRTIQGATRE
PF02559         ----------------------------------------KPGDYVVHPNHGVGRIEGIETIEIGGEPRE
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWXXXXXXXXXXXXEIAGDLIRLYx
PF02559         YYVLEYA------FGDKLYVPVDQLDLVSRYVGSEEPKLDKLGGGEWKKRKRKAKSGVRDIAAELIRLY-
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDRLICGDVGYGKTEVAVRAAF
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         -------------------------------------------------DVLVAAPTGSGKTLAILQALL
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ETLKNGPQALILAPTRELAEQIYERLKKLLKEPGLRVGLLVGGVSIEEQLRV---LRKG-VDIVVGTGRL
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         LDGKLNLSNLRLLVLDEDQGFGDDLRKILKRLPKKRQTLLFSAT-LPRLLDI------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRVAWAHGQMNEHQLERV
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         -----------------------------------------------------RVARLHGDLSQEEREEI
PF01432         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         LERFRRGEVKVLVATDVAERGLDIPDVD-LVIDFDLPWSPASYIQRIGRAGRAQ----------------
PF01432         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         ----------------------------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
PF02559         ----------------------------------------------------------------------
PF03461         -------DLPVDAYIPEDYIPDERQRLELYKRIASAETEEELEELQEELIDRFGPLPEEVENLLEIARLK
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ------------------YAPDRELRKKAYRAYYTRASETDNAAILEELL--------------------


                         .         .         +         .         .         .         .:1190
query           VLARSAGLTDVVLQGTQIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02559         ----------------------------------------------------------------------
PF03461         LLAKKLGIEKIKAKGKGI----------------------------------------------------
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------
PF01432         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxx
PF02559         --------------------
PF03461         --------------------
PF00270         --------------------
PF00271         --------------------
PF01432         --------------------