[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54538.1

[Show Plain Result]


## Summary of Sequence Search
    1::490
   24::256     7e-31  35%  256 aa  PF00069 Pkinase "Protein kinase domain"
   22::251     1e-15  30%  254 aa  PF07714 Pkinase_Tyr "Protein tyrosine kinase"
    1::490

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDGARVAVKTLHRDA
PF00069         ---------------------------------------------------------GELVAVKIIKKKS
PF07714         --------------------------------------------------------DGTEVAVKRLKEGS


                         .         .         *         .         .         .         .:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
PF00069         LDEKE-EERALREIRILKRLRHPNIVRLLDVFEDGDHLYLVMEYCPGGSLFDLLKKKGPLSEEEARKIAR
PF07714         SQ--GELEEFLNEVEILSKLRHPNLVRLLGVCTEGGPLLLVYEYMPNGSLDDYLRERPPLDWKQRLKIAL


                         +         .         .         .         .         *         .:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
PF00069         QILRALAYLHSKGIIHRDLKPENILLEDGNVKLIDFGLAKLLLSSGERLTTVVGTPGYMAPEVLLGGGYT
PF07714         QIARGLEYLHSKKIIHRDLKARNILLDENVAKISDFGLARLLDDYYHVSTRVKGPIGWMAPEYLRTGKFT


                         .         .         .         +         .         .         .:280
query           PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETL
PF00069         KKVDIWSLGVILYELLTGRPPFDGESEEELIEKILGGPLPFSDSSPELKDLIRRLLQKDPEKRPTAEEAL
PF07714         EKSDVYSFGVLLWEILTGRRPYPGLSNEEVLELVDDEIPE--DCPEELYELMLLCWQEDPEDRPTFSEVV


                         .         *         .         .         .         .         +:350
query           MLVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         KLL-------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------