[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54591.1

[Show Plain Result]


## Summary of Sequence Search
    1::553
    3::161     3e-22  38%  170 aa  PF02776 TPP_enzyme_N "Thiamine pyrophosphate enzyme, N-terminal TPP
    7::137     2e-17  38%  139 aa  PF02775 TPP_enzyme_C "Thiamine pyrophosphate enzyme, C-terminal TPP
    5::138     4e-07  31%  138 aa  PF00205 TPP_enzyme_M "Thiamine pyrophosphate enzyme, central
    1::553

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
PF02776         -------------GAQALVEALKRQGVKHVFGVPGSRNLPLLD-ALAAHPGIRHILARHEQGAAFAADGY
PF02775         ----------------------------------------------------------------------
PF00205         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
PF02776         ARATGKPGVVIVTSGPGATNLLTALAEAYADRVPLLVLTGDRPAELIGTGAFQEIDQVGLFRPVTKYSDR
PF02775         ----------------------------------------------------------------------
PF00205         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARLLSEAE
PF02776         VTDPEQLPEALDRAFRVADSGRPGPVHLNLPQD-------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         --------------------------------------------------------------AELLAKAK


                         .         .         .         +         .         .         .:280
query           RPVLVYGSDVWLDHXXXXXXXXXXXXGVPVVTNGQGRGVLPAGHPXXXXXXXXXXXXXXDLVIVVGTPLD
PF02776         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         RPVILVGGGVRRAGASAELRELAEKLGIPVATTLMGKGAFPEDHPMHGTPAANEAVEEADLVLAVGARLD


                         .         *         .         .         .         .         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAxxxxxxxxxxxxxxxxxxx
PF02776         ----------------------------------------------------------------------
PF02775         ----------------------------------------------------------------------
PF00205         DTRTTGY--SAKFAPEAKIIHIDIDPAEIGKNYPPDVPIVGDAKAALELLA-------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRPGNWLDPGPFGCL
PF02776         ----------------------------------------------------------------------
PF02775         --------------------------------------------------------RPRSWLDSGGLGSM
PF00205         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
PF02776         ----------------------------------------------------------------------
PF02775         GYGLPAALGAALANPDRRVVAVIGDGAFGMSLQELNTAVRYGLPIIIVVLNNEGYGM-TGGQQTPFGAKR
PF00205         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVxxxxxxxxxxxxxxxxx
PF02776         ---------------------------------------------------------------
PF02775         YSDLLPNPDFAKLAEAYGAKGARVTTPEELEKALKEALATDGPVLI-----------------
PF00205         ---------------------------------------------------------------