[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54630.1

[Show Plain Result]


## Summary of Sequence Search
    1::603
    5::251     4e-35  37%  256 aa  PF00069 Pkinase "Protein kinase domain"
    1::253     9e-20  28%  254 aa  PF07714 Pkinase_Tyr "Protein tyrosine kinase"
   60::156     5e-05  34%  187 aa  PF01163 RIO1 "RIO1 family"
    1::603

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
PF00069         -----------------------KKLGEGGFGTVYLARDKDTELVAVKIIKKK-SLDEKEEERALREIRI
PF07714         -------------------FSLGNKLGEGGFGKVYKGTLRDGTEVAVKRLKEGSSQGELEE--FLNEVEI
PF01163         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIH
PF00069         LKRLRHPNIVRLLDVFEDGDHLYLVMEYCPGGSLFDLLKKKGPLSEEEARKIARQILRALAYLHSKGIIH
PF07714         LSKLRHPNLVRLLGVCTEGGPLLLVYEYMPNGSLDDYLRGRPPLDWKQRLKIALQIARGLEYLHSKKIIH
PF01163         ------RNLKRLYEAGVPVPEPILVMEFIPAPRLKDVEL---PEEARELYEELIEYMRRL--LHKAGLVH


                         +         .         .         .         .         *         .:210
query           RDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFA
PF00069         RDLKPENILLEDGNVKLIDFGLAKLLSGERLT---TVVGTPGYMAPEVLLGGGYTKKVDIWSLGVILYEL
PF07714         RDLKARNILLENLVAKISDFGLARLLYSDDYYHVSTRVKGPGWMAPEYLRTGKFTEKSDVYSFGVLLEIL
PF01163         GDLSEYNILVDEDKPVIIDFPQAVEAD-------------------------------------------


                         .         .         .         +         .         .         .:280
query           ATGNPPYGAGAFEVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARxxxxxxxxxxxxx
PF00069         LTGRPPFDGESEEELIEKILGGPLPFDSSPE-LKDLIRRLLQKDPEKRPTAEE-----------------
PF07714         TLGRRPYPGLSNEEVLELVDDGEIPED-CPEELYELMLLCWQEDPEDRPTFSEVVER-------------
PF01163         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01163         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01163         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01163         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01163         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00069         -------------------------------------------
PF07714         -------------------------------------------
PF01163         -------------------------------------------