[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54828.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
    1::106     2e-04  33%  106 aa  PF04020 DUF360 "Membrane protein of unknown function"
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVGCIFYYXXXXX
PF04020         MRFLLRWLVNAVALLVVAGLLPGIEVAG------FGTALIAALVLGLLNALVKPILKLLTLPLTILTLGL


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXXGIPFEIDGFWAAFWGAIIVAIVSWLLxxxxxxxxx
PF04020         FGLVINALMLLLASWLVPG----FTVDGFWSALLGAIVISIVSWII---------