[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ54978.1

[Show Plain Result]


## Summary of Sequence Search
    1::1077
    4::239     1e-17  32%  246 aa  PF08376 NIT "Nitrate and nitrite sensing"
    4::110     3e-07  36%  112 aa  PF02518 HATPase_c "Histidine kinase-, DNA gyrase B-, and HSP90-like
   18::61      0.001  52%   69 aa  PF00672 HAMP "HAMP domain"
    1::1077

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxLGNELGKERMLVAAYIADNPNPTRRSNDRAVALQEQQKIVDQELNDVRAGA
PF08376         -------------------LVHALQKERGLSAGYLASG------GKRFAAELTAQRAATDAALAALRAAL
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTMLPAVTKYRQIISTLTDFVETLANATNTSSEL
PF08376         AELDASPLPQLRRRLAAILQALDRLPALRKRVDALSISPAEAFAYYTELIASLLDLIDELADLTD-DPEL
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RESVRALSALGRARDDQSYEAALMVHSLIRDSMSGGVQDSIESTQARYNNEIRNFRNSATPAQEALLDEN
PF08376         ARLLRALVALLQAKEAAGQERALGAGALAAGELSPEQYARLVSLIAEQRAALEEFVAAASPEARALLDAL
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGGLDVSRLGTMRLRALLRADEGQPLTGITDGDDADSYQQTALSALDTLAKVESSLAxxxxxxxxxxxxx
PF08376         VSGPAVQRVERLRDAALAQAPGGDLL-----GIDAEDWFAAATARIDLLRKVEDALA-------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxVARSMVIPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         -------------------------LARRLTRPLRRLAEAAERIAEGDL----------SVR--------


                         .         .         +         .         .         .         .:490
query           LEVDSSDEFGEVARSFDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         IPVDGRDEIGELARAFN-----------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
PF08376         ----------------------------------------------------------------------
PF02518         --NRLRQILRNLVSNAIKATPEGGRITVTIK-LDGGDLTIEVEDNGIGIPPELLE----RLFEPFFTDDS
PF00672         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         DSRKLGLSIVRQLAELMGGTITVESKPGGGTTFTFTLP--------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08376         ---------------------------
PF02518         ---------------------------
PF00672         ---------------------------