[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55004.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
   16::188     2e-42  49%  191 aa  PF01596 Methyltransf_3 "O-methyltransferase"
   95::210     6e-05  28%  245 aa  PF06325 PrmA "Ribosomal protein L11 methyltransferase (PrmA)"
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMQIAPEQGLFLTLLTQLIGARNIVEVG
PF01596         -------------------------------------------MAVSPEQGQFLYLLVRLIGAKRILEIG
PF06325         -----------------------------------------------PTTRLCLEALEKLVKGKTVLDVG


                         .         .         *         .         .         .         .:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
PF01596         TYTGYSALWLALALPEDGKITTIEINPERAEIARENIEKAGLADRIDLREGDALETLPRLLEEGEFDFIF
PF06325         CGSGILAIAAAK--LGAKKVLAVDIDPVAVEAARENAELNGVSDRITVYL------LEDLPEGGKFDVIV


                         +         .         .         .         .         *         .:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
PF01596         IDADKDNYLNYLELALRLLRPGGVIVADNVLWPGRVADPDARDRKTVRIREFNEALAADPRVETTLLPIG
PF06325         ANILADVLIELAPDIARLLKPGGLLILSGI----------------------------------------


                         .         .         .         +         .         .         .:280
query           DGFTxxxxx
PF01596         DGLT-----
PF06325         ---------