[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55025.1

[Show Plain Result]


## Summary of Sequence Search
    1::107
    3::83      5e-12  51%   93 aa  PF00893 Multi_Drug_Res "Small Multidrug Resistance protein"
    1::107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAYGIWSALGVTL
PF00893         --WLYLILAILLEVIGTIGLKLSEGFTRLLPSILTLVAYGLSFYLLSLALK-TLPLGVAYAVWSGIGIVG


                         .         .         *         .         .         .         .:140
query           VAVIGAVFLGDTLTxxxxxxxxxxxxxxxxxxxxxxx
PF00893         TALAGILLFGESLS-----------------------