[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55030.1

[Show Plain Result]


## Summary of Sequence Search
    1::236
   13::113     7e-07  35%  118 aa  PF03099 BPL_LplA_LipB "Biotin/lipoate A/B protein ligase family"
    1::236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTDPGAP
PF03099         ---------------------------------------------------------------LKEGGIP


                         .         .         *         .         .         .         .:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
PF03099         VARRQTGGRRTWHSPGGNLYYSLLLLPPPSDLRGLSLLLGLAVLEALAE-------GEGLTGVWLKWPND


                         +         .         .         .         .         *         .:210
query           RGLPERKIAAIGCRIAKGVTMHGFALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03099         IYVGGKKIAGILVELRRGGSLHGVVL--------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF03099         --------------------------