[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55194.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
    1::204     1e-63  66%  229 aa  PF00977 His_biosynth "Histidine biosynthesis protein"
  140::224     9e-07  36%  303 aa  PF01207 Dus "Dihydrouridine synthase (Dus)"
  131::167     9e-05  41%  175 aa  PF04309 G3P_antiterm "Glycerol-3-phosphate responsive
  131::245     4e-04  26%  245 aa  PF05690 ThiG "Thiazole biosynthesis protein ThiG"
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
PF00977         -----RIIPCLDVKDGRVVKGDQFTNLRDAGDPVELAKRYYEQGADELHFLDLTAAREGRPTNLEVVERI
PF01207         ---------------------------------LELARRLEDAGAAALTVHGRTRKQRYEPADWEYIAEV
PF04309         -----------------------------------------------------------------VIKEI
PF05690         -------------------------------DPV-LAKRLEEAGCAAVMPLGAPIGSGLGLVNPYNLRII


                         .         .         *         .         .         .         .:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
PF00977         AEAVFIPLTVGGGIRSLEDAEALLRAGADKVSIGSAAVKNPELIEEAAERFGSQCIVVSIDAKR------
PF01207         KEAVPIPVIANGDITSLEDALRMLETGADGVMIGRGALGNPWLFRE------------------------
PF04309         KEETGVPIIAGGLIRTKEDVEEALKAGATAVS--------------------------------------
PF05690         IEQADVPVIVDAGIGTPSDAAQAMELGADAVLVNTAIAKAKDPVAKLAVEAGRLAYLAGRIPRRDYASAS


                         +         .         .         .         .         *         .:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
PF00977         --GEYEVATNGGRESTGIDAVELAKEVEELGAGEILLTDIDRDGTLSGFDLELLRALAEAVSIPVIASGG
PF01207         ----------------------------------------------------------------------
PF04309         ----------------------------------------------------------------------
PF05690         SP--------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGAVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00977         AGSLE-----------------------------------------
PF01207         ----------------------------------------------
PF04309         ----------------------------------------------
PF05690         ----------------------------------------------