[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55328.1

[Show Plain Result]


## Summary of Sequence Search
    1::392
    6::314     8e-21  34%  319 aa  PF01094 ANF_receptor "Receptor family ligand binding region"
    1::392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDL
PF01094         --------------------------------------------------------------------EL


                         .         .         *         .         .         .         .:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
PF01094         AVDEINAAGGLG-PKIELVVEDDDSDPDEAAAAARKLIDSDGVVAVIGPSSSSVALAVAPVAEEAGIPQI


                         +         .         .         .         .         *         .:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
PF01094         SPSATSPALTDKSYFFRTVPSDSQQARALADLLKKFGWKKVAIIYDDDDKALKALGGKVVAVVVYPSGDT


                         .         .         .         +         .         .         .:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
PF01094         ------------DFSALLTKLKASKADVVVLFGSGADAALLLKQARELGLGGGYVWIGSDGWSSSEGAGD


                         .         *         .         .         .         .         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
PF01094         AAEGVL---GFTPDPDNPGFKEFVERYKKKGGEEPSAYAALAYDAVYLLAEALEKAGSTDRAALLRALKK


                         .         .         .         .         *         .         .:420
query           VAAEGFDGAQGPLSFENNDVRVxxxxxxxxxxxxxxxxxxxx
PF01094         VS---FEGVTGPVSFDDNGDRL--------------------