[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55520.1

[Show Plain Result]


## Summary of Sequence Search
    1::389
   23::85      1e-04  41%  131 aa  PF02803 Thiolase_C "Thiolase, C-terminal domain"
    1::389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02803         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02803         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02803         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAAQSGPAALRMAGVTVDEI
PF02803         --------------------------------------------------GPVPAAPKALARAGLTLDDI


                         .         *         .         .         .         .         +:350
query           DIREIYDCFTYTTLLTLEDYGFCAKGEGGEFVASGALAPGGSHPTNTGGGELSxxxxxxxxxxxxxxxxx
PF02803         DVIEINEAFAAQELAVLEALGLDPKGEG----------IGGREKVNVNGGAIA-----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02803         ---------------------------------------