[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55524.1

[Show Plain Result]


## Summary of Sequence Search
    1::656
   83::339     4e-41  41%  340 aa  PF00724 Oxidored_FMN "NADH:flavin oxidoreductase / NADH oxidase
    1::64      2e-10  48%   78 aa  PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"
  136::171     5e-07  61%  275 aa  PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
    2::35      2e-06  53%  159 aa  PF01210 NAD_Gly3P_dh_N "NAD-dependent glycerol-3-phosphate
    1::32      4e-05  59%  338 aa  PF01494 FAD_binding_3 "FAD binding domain"
  163::277     4e-04  36%  328 aa  PF01070 FMN_dh "FMN-dependent dehydrogenase"
    2::27      6e-04  62%  368 aa  PF05834 Lycopene_cycl "Lycopene cyclase protein"
    1::34      0.001  48%  282 aa  PF04321 RmlD_sub_bind "RmlD substrate binding domain"
    4::41      0.001  34%  247 aa  PF00743 FMO-like "Flavin-binding monooxygenase-like"
    1::656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00724         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
PF00724         --------------------------------KKVTDAVHAAGGKIFIQLWHAGRLPGGPAPSAPSALAG
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         --------------------------------------------------------PKGPTGALAAWLAS
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
PF00724         TPPRALTTEEIKEIIEDFAQAAKRAKEAGFDGVEIHGAHGYLLDQFLSPLTNKRTDEYGGSLENRARFLL
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         QFDPSLSWDDIEWLREQWPEDARRAVDAGVDGI---------------VVSNHGGRQLDGG-PSTIDALP
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
PF00724         EVVDAVRAAVGADFPVGVRLSPTDFVEGGLTLEETAELAKLLEELG-VDLLDVSGGAHIAEPRPRGAFPV
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         EIVDAVRIEVLADGGIRRGLDVLKALALGADA--------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVxxxxx
PF00724         EPGYQLPFAEAIRKAVGIPVIAVGGITTPEQAEEALAEGDADLVALGRPFLADPDLVKKLAEGRL-----
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
PF00724         ----------------------------------------------------------------------
PF00070         -----------------------------------------KVAVVGGGPAGLEAAGVLARLGHKVTLVE
PF07992         ---------------------------------------PKRVVVVGGGNTGLELAGALARLGAEVTVVE
PF01210         -----------------------------------------KIAVLGAGSWGTALAKVLARNGHEVTLWG
PF01494         ---------------------------------------PRDVLIVGAGPAGLALALALARAGIDVTVLE
PF01070         ----------------------------------------------------------------------
PF05834         ------------------------------------------VVVVGGGPAGLALAARLAKAGLSVLL--
PF04321         ----------------------------------------KKILITGAGQLGRELQRLLAERGYEVVALD
PF00743         ------------------------------------------VAIIGAGPSGLAAAKRLLEEGLDPVVFE


                         .         .         +         .         .         .         .:490
query           REEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATxxxxxxxxxxxxxxxxxxxxxxxx
PF00724         ----------------------------------------------------------------------
PF00070         RRDRLGPQLD-----------EEISKYLQERLEKLGVEVRLNTRVT------------------------
PF07992         RRRRL-----------------------------------------------------------------
PF01210         RDEEL-----------------------------------------------------------------
PF01494         R---------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         RSE-------------------------------------------------------------------
PF00743         KADDIGGTWR------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00724         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00724         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF01210         ----------------------------------------------------------------------
PF01494         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF00743         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF00724         --------------------------
PF00070         --------------------------
PF07992         --------------------------
PF01210         --------------------------
PF01494         --------------------------
PF01070         --------------------------
PF05834         --------------------------
PF04321         --------------------------
PF00743         --------------------------