[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55679.1

[Show Plain Result]


## Summary of Sequence Search
    1::854
    1::732     e-146  51%  733 aa  PF01804 Penicil_amidase "Penicillin amidase"
    1::854

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAPVTVYRDEYGITHLYADT
PF01804         ---------------------------------------------------APVTIRRDAYGVPHIYADN


                         .         .         *         .         .         .         .:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
PF01804         DHDLFFGQGYAHAQDRLFQMDLLRRTARGRLSEVFGPAALDSDRFFRTLGLRRAAEASLAALSPETRALL


                         +         .         .         .         .         *         .:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLAR
PF01804         QAYAAGVNAYL-AKAGRKLPLEFALLG-----YEPEPWTPEDSLAIGKLMAFDLGGGL-QELARALLLA-


                         .         .         .         +         .         .         .:280
query           GLPREQVEELYPAYPEEQHAPILAGGRVRDGKFVLXXXXXXXXXXXXXXIPATAAVRALAGLQEPLEAIP
PF01804         ALGAEQGAELLPIYPADPPPAALA--------------------------PAGPA--AAAGLPDALAAAA


                         .         *         .         .         .         .         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
PF01804         ALLAAGANGIGSNNWAVSGSRTASGKPLLANDPHLGLSAPSIWYQAHLTAPGL------DVIGATLPGLP


                         .         .         .         .         *         .         .:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
PF01804         GVVIGHNGHIAWGHTNSGADVQDLYLEKLNPDDPLYDGGWEPMTTRTETIKVKGGDPVTLTVRRTRHGPV


                         .         .         +         .         .         .         .:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
PF01804         ISD-DAGGLTGT----------------------AYALRWTALDPNRSLDAFLALNRARDVDEFRAAAAY


                         *         .         .         .         .         +         .:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
PF01804         FGVPSQNTVYADRDGNIGYQAAGRVPVRSPGDGRLPVPGWDGRYEWQGYLPFDELPRVINPPSGYVVTAN


                         .         .         .         *         .         .         .:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVEVDVXXX
PF01804         NRPVAPDYPYTLGGDWGPGYRARRIRELLE---AKEKFTVEDMQALQLDNRSLAARLLLPDLLAASADPD


                         .         +         .         .         .         .         *:700
query           XXXXXXXXXXWXXXXXXXXXXXXXYNATYRHLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGE
PF01804         AAEALALLAAWDGRADADSVGAALFRAWLRELLRRLFDELG--PLVFAAFDPLLLDSLLWALGAPLW-DD


                         .         .         .         .         +         .         .:770
query           EVSSRDEALRVAMERAAAELTELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSS
PF01804         VTTTRDDLLRAALADALAELEAALGPDPADWRWGDLHTLRPTH-PLPLPGL-------NVGPVPAGGDGD


                         .         .         *         .         .         .         .:840
query           VVNATGWDPAQGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS
PF01804         TVNATGYNRGGGFGVTHGPSYRMVVDFGDGDRARFILPGGQSGHPLSPHYADQLELWARGEYRPLPFTEA


                         +         .         .         .         .         *         .:910
query           AVEEAAxxxxxxxx
PF01804         DIEALA--------