[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55755.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
    1::382     e-114  59%  382 aa  PF06187 DUF993 "Protein of unknown function (DUF993)"
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLRLPTPTGELETYXXXXXXXXXXXXXXXXXXXAYAAAHVVADPLGSNGPGQPAQLDWDATLAFRH
PF06187         -----LKLPTADGSLRDYALRGTPPPAPPAAPAFSRIAYAAAHVVADPLADNDPWAPAAIDWDATLAFRR


                         .         .         *         .         .         .         .:140
query           YLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGVGTDHLEPSQATLESVIKAYRE
PF06187         HLWSLGLGVAEAMDTAQRGMGLDWAAARELIRRSAAEARAVGALVACGAGTDHLDPAPASLDDVIRAYEE


                         +         .         .         .         .         *         .:210
query           QLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLADVDRPVILHWLGAVFDPALDGYWGYTXXXXX
PF06187         QLAAVEKAGGRVILMASRALARAARGPDDYLRVYGRLLSQADQPVILHWLGEMFDPALAGYWGSADLDAA


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXRVDGIKVSLLDDTLEVRLRTLLPDGVRLYTGDDFNYPDLILGDADGHSHXXXXXXXX
PF06187         TDTVLELIAAHADKVDGIKISLLDADKEIALRRRLPEGVRMYTGDDFNYPELIAGDGQGHSHALLGIFDA


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXDDGDTDRYRALLAPTVPLSRHLFAAPTYYYKTGITFVAWLNGHQKGFSMVGGLQSARD
PF06187         IAPAASAALQALDAGDTAEFRAILDPTVPLSRHIFRAPTRYYKTGVVFLAWLNGHQDHFTMVGGLQSARS


                         .         .         .         .         *         .         .:420
query           LPHLATAFRLADAAGVLTDPETAVSRMRTLLTVYGVxx
PF06187         LPHLAELFRLADQAGLLPDPELAAARMRSLLAVYGV--