[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55880.1

[Show Plain Result]


## Summary of Sequence Search
    1::252
    1::122     2e-19  47%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTLMHCMAGLDT
PF00005         ----------------------------------------------------------STLLRLLAGLLK


                         .         .         *         .         .         .         .:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
PF00005         PTSGKILLDGV-ISPLE------LRKLRIGYVFQDPALFPHLTVRENIAFGLKNDKKKEAKEEILEALER


                         +         .         .         .         .         *         .:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         VGLLKFLYRYPHELSGGQRQRVAIARALIKEPKVLLLDEPT-----------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ------------------------------------------