[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55924.1

[Show Plain Result]


## Summary of Sequence Search
    1::707
    6::291     1e-26  45%  296 aa  PF00128 Alpha-amylase "Alpha amylase, catalytic domain"
    2::81      4e-07  51%   82 aa  PF02922 CBM_48 "Carbohydrate-binding module 48 (Isoamylase
    1::707

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
PF00128         ----------------------------------------------------------------------
PF02922         -------------LGAHYDGDGVNFAVWAPNAKRVELVLFNGDGEEHPMTLKDEGG-VWEVFVPGGLPGT


                         .         .         *         .         .         .         .:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00128         ----------------------------------------------------------------------
PF02922         LYKYRVDGPG--------GPNKLLLDPY------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEHLLSLGVTAVELMPIHHF
PF00128         --------------------------------------------------LDYLKDLGVTAIWLLPIFE-
PF02922         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
PF00128         ---------SPQNYWGYDPLDYFAVDPRYGT-------LEDFKELVDAAHKRGIRVILDVVYNHTSE-DH
PF02922         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
PF00128         FGPSLSSRGSPYRDYYIWRGSPPNYYFGWTDDGNDLNTENPEVREEIIDVLRYW-LDEGVDGFRFDAAKH
PF02922         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
PF00128         LPKEF-----WREFRDAVRE--IAPDAFLVGEVWDGDPDGYMVFDFPLF----------DLRDNAFG-PD
PF02922         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
PF00128         AADLANILDGWLDAYP----DPGWAVNFLDNHDTQRLA----------------SRFGDDEDRA------
PF02922         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00128         ----------------KLAAALLLTSPGTPMIYYGDEIG-------------------------------
PF02922         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00128         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxx
PF00128         -------
PF02922         -------