[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ55991.1

[Show Plain Result]


## Summary of Sequence Search
    1::252
    9::165     4e-17  48%  193 aa  PF01955 CbiZ "Adenosylcobinamide amidohydrolase"
    1::252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRMAASSVLGGGLGPRDYVINAQVDGDYRRTDPD
PF01955         -------------------------------------RVLSSAPLNGGLGRADAVFNHQVPKDYDREDPE


                         .         .         *         .         .         .         .:140
query           NHLEELATHFGMTGTGVGLLTAANVSEACFADDHGVEVLATVGLGRPTWAAADPALDEARLPGEETRPGT
PF01955         EYLAELLERLGLDGDAVGLLTAVDMDNAAIATEESVTAIVTAGVSNAA-RAGDPAEDEA-----SGEPGT


                         +         .         .         .         .         *         .:210
query           INIVVAVPAPMSDTALVNLVATATEAKVQALFDSGYACTGTASDAVCVAAxxxxxxxxxxxxxxxxxxxx
PF01955         INIIVLTNASLTDGALVNAIITATEAKTAALQELGIRATGTGTDAVAVAS--------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01955         ------------------------------------------