[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56010.1

[Show Plain Result]


## Summary of Sequence Search
    1::389
    8::234     1e-07  27%  236 aa  PF00563 EAL "EAL domain"
    1::389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
PF00563         -------------------------LENGEFELYYQPIVDLRTGRIVGYEALIPLAEETGLIVELDRWVL


                         .         .         *         .         .         .         .:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
PF00563         EEACRQLAAQGPDLRLSVNLSPRQLL-DPDFVERLLELLAETGLPPERLVLEITESALIEDDAELLALLR


                         +         .         .         .         .         *         .:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
PF00563         RLRALGVRIAFGTGYSSLSYLKRLPVDILKIDRSFVRDIDTDPEDRAIVRAIIALAHSLGLKVIAEGVET


                         .         .         .         +         .         .         .:280
query           IAQLTALRTVGVRMAQGPLFAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00563         EEQLELLRELGCDLFQGYLFS-------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00563         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00563         ---------------------------------------