[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56050.1

[Show Plain Result]


## Summary of Sequence Search
    1::335
    1::148     2e-46  61%  148 aa  PF00044 Gp_dh_N "Glyceraldehyde 3-phosphate dehydrogenase, NAD
    1::156     2e-41  56%  156 aa  PF02800 Gp_dh_C "Glyceraldehyde 3-phosphate dehydrogenase,
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
PF00044         ---KVGINGFGRIGRLVLRA--ALKRPDIEVVAINDLFDPEYLAYLLKYDSVHGRFKGTVEVDDDKLVVN
PF02800         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
PF00044         GKKIKVFAERDPANLPWGELGVDVVVESTGVFTTKEKASAHLKAGAKKVVISAPSKDDAPTFVMGVNHDE
PF02800         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YDPANHHILSNASCxxxxVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
PF00044         YDP-DDDIVSNASC--------------------------------------------------------
PF02800         ------------------LAPLAKVLNDNFGIEEGLMTTVHAYTATQKTVDGPSKDWRRGRAAALNIIPT


                         .         .         .         +         .         .         .:280
query           TTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTXXXXXXXXXXXXXXXXXDILVYTED
PF00044         ----------------------------------------------------------------------
PF02800         STGAAKAVGKVLPELNGKLTGMAVRVPTPNVSVVDLTVRLEKPATYEEINAALKEASEGPLKGILGYTED


                         .         *         .         .         .         .         +:350
query           PIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWxxxxxxxxxxxxxxxxxxxxxx
PF00044         -------------------------------------------------------
PF02800         PLVSSDFIGDPHSSIFDATATIVLGGNVKVVSW----------------------