[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56054.1

[Show Plain Result]


## Summary of Sequence Search
    1::656
   11::156     7e-47  66%  156 aa  PF08459 UvrC_HhH_N "UvrC Helix-hairpin-helix N-terminal"
    2::79      2e-07  39%   80 aa  PF01541 GIY-YIG "GIY-YIG catalytic domain"
    1::656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
PF08459         ----------------------------------------------------------------------
PF01541         -----------------PGVYIIYDKDGGVLYIGKANNLRRRLRQHLSGEDG--KKTKLKHNGRSNFELL


                         .         .         *         .         .         .         .:140
query           VVNTEVEALQLEYSWIKEYSPRFNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01541         IVETKSEALDLENLLIKLYQPGEN----------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPLRIECFDISTLQGEH
PF08459         ------------------------------------------------------PLRIECFDISHIQGTD
PF01541         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
PF08459         AVASMVVFEDGGPDKSEYRRFNIKGVTGGD-DYAAMREVLTRRFSRLLKE-------------GAPL---
PF01541         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
PF08459         ---------PDLILIDGGKGQLNAAREVLDELGLDDIPVVGLAKGLERLFLPGEKEPIILPRNSPALYLL
PF01541         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QRVRDEAHRFAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         QRIRDEAHRFAI----------------------------------------------------------
PF01541         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF08459         --------------------------
PF01541         --------------------------