[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56085.1

[Show Plain Result]


## Summary of Sequence Search
    1::399
    1::386     e-119  55%  390 aa  PF00764 Arginosuc_synth "Arginosuccinate synthase"
    1::399

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
PF00764         -----VLAYSGGLDTSVILKWLKEKYGAEVIAFTADLGQG-EDLEAIEEKALKLGAKKAYIIDLREEFVE


                         .         .         *         .         .         .         .:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
PF00764         DYIFPAIQANALYEGTYLLGTSLARPLIAKALVEIAKEEGADAVAHGCTGKGNDQVRFELAFYALNPDLK


                         +         .         .         .         .         *         .:210
query           VLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYDYTQNPAE
PF00764         VIAPWRDWDFSREELIEYAEEHGIPVPASKEKPYSIDANLWGISHEGGILEDPWNEPPEDMYGWTVSPED


                         .         .         .         +         .         .         .:280
query           PREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLI
PF00764         PDEPEYVTITFEKGVPVALNGKKLSPVELILELNEIGGKHGIGRIDIVENRLVGMKSRGIYEAPGGTILL


                         .         *         .         .         .         .         +:350
query           TAHQELENVTVERELARFKRWVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVT
PF00764         KAHRDLESLTLDREVAHLKDQLGRKYAELVYNGLWFSPLREALQAFIDETQENVTGEVRLKLYKGNVIVL


                         .         .         .         .         *         .         .:420
query           GRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIxxxxxxxxx
PF00764         GRKSPNSLYSEELATFEEGDAFDQKDAEGFIKLNGLRLKI---------