[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56165.1

[Show Plain Result]


## Summary of Sequence Search
    1::167
    3::149     8e-13  38%  149 aa  PF00484 Pro_CA "Carbonic anhydrase"
    1::167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVTCMDSRIEPLEMLGLKPGDAKILRNAGARVTDDTL
PF00484         ---------------------------------VIGCSDSRVPPELIFGLGPGDLFVVRNAGNLVTDDSL


                         .         .         *         .         .         .         .:140
query           RTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLEFHTDSDQIGALHRDVERIRH
PF00484         ASLEYAVDVLGVKHIIVCGHSDCVKAALDGDNWLEHIRPAKEKVHRAELDAPSREDLVEEVLQQVENLRT


                         +         .         .         .         .         *         .:210
query           HPLLPPDLPVMGAIYDVDTGRVxxxxx
PF00484         HPLVKGTLKVHGWVYDIETGEI-----