[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56191.1

[Show Plain Result]


## Summary of Sequence Search
    1::515
    2::404     5e-76  45%  405 aa  PF00501 AMP-binding "AMP-binding enzyme"
    1::515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
PF00501         -----------------------------YAELDERVNRLAAGLRALGVKPGDRVAILLPNSPEFVVALL


                         .         .         *         .         .         .         .:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
PF00501         ACLKAGAVAVPLNPTLPAEELAYILNDSGAKVLITLEALAKLPL---LLAIIVSLGEEGLLLDALLAAAA


                         +         .         .         .         .         *         .:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
PF00501         PAPAPP------------------VPVDPDDLAYIIYTSGTTGKPKGVVLTHRNLLANAAALAAALGLTP


                         .         .         .         +         .         .         .:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
PF00501         G--DRVLSVLPLHHDGGVGGLLGP-LLAGATLVLLPGFDPERLLELIEKYRVTVLFAVPTLLRALLKAPE


                         .         *         .         .         .         .         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
PF00501         ER--KYDLSSLRLVLSGGEPLPPELLERFRERFGIPLVNGYGLTETGGVVTVNPPGDPDKPGSVGRPLPG


                         .         .         .         .         *         .         .:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
PF00501         VEVRIVDPDGRPVPPGEVGELVVRGPGVMRGYWNDPEATAEAFADGWYRTGDLGRLDEDGYLFILGRKKD


                         .         .         +         .         .         .         .:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00501         LIKVGGENVEPAEIEAALLSHPGVAEAA------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00501         -------------------------