[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56219.1

[Show Plain Result]


## Summary of Sequence Search
    1::407
   88::354     5e-34  38%  357 aa  PF01098 FTSW_RODA_SPOVE "Cell cycle protein"
    1::407

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01098         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGSRSWIALGDLRVQPA
PF01098         -----------------------------------------------------NGAKRWIRLGGFSFQPS


                         +         .         .         .         .         *         .:210
query           ETAKXXXXXXXXXXXGXXXXXXXXXXASDVLISLGVAAVPIGLILLQPDLGSALVLTAIYLALLACSGAP
PF01098         EFAKIALILFLASYLSRKQKEKRPRLKG-LLPPLLLVLLPLLLILLQPDLGTALVLFAIFLGMLFLAG--


                         .         .         .         +         .         .         .:280
query           LRWPLALLGCGAFTGLAVWQLGLLKDYQVARFTAFLDPHADPLGAGYNVNQALIAVXXXXXXXXXXXXXX
PF01098         IRWKYILGLLLLLIGVALVLLILLKPYQKARILAFLDPESDPLGAGYQLIQSLIAIGSGGLFGKGLGNGT


                         .         *         .         .         .         .         +:350
query           QTSGKFVPEQHTDFVFSVAAEELGFAGGCAXXXXXXXXXXXXXXXASRCDEVHGRLVCIGVAAWFCVQVF
PF01098         QKLG-YLPEAHTDFIFAVIGEELGFIGALLVLLLFLLLILRGLRIALRAKDPFGRLLAAGIASMIFFQVF


                         .         .         .         .         *         .         .:420
query           VNIXXXXXXXXXXXXXXXFVSYGGSAAVANFAALGLVMAVHAHxxxxxxxxxxxxxx
PF01098         INIGMVIGLLPVTGIPLPFISYGGSSLLANMIAIGILLSISRH--------------