[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56286.1

[Show Plain Result]


## Summary of Sequence Search
    1::430
   17::244     2e-19  38%  341 aa  PF00155 Aminotran_1_2 "Aminotransferase class I and II"
    1::430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTGGDQNGYGPVAGIRELREAAAGY
PF00155         ---------------------------------------------AAGGGLLGYGPPQGLPELREAIADF


                         .         .         *         .         .         .         .:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
PF00155         LRRRGVPVDPEEILVTSGAQALLLQLLLDPGDEVLVPEPTYPSYIAAARLAGAEVVPVPLDEDDFGL-DL


                         +         .         .         .         .         *         .:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
PF00155         EALEAALTEAKT-----KLIVLPNPNNPTGAVLSLEELEELAELARKYDLLIIEDEAYGELVYGGEDFVS


                         .         .         .         +         .         .         .:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
PF00155         ALASLDGDPNVIVLGFSKAFGLPGLRLGYIVAP-----PELIEALRKLARPL-TSPSTPLQAAAAAALSD


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00155         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00155         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxx
PF00155         ----------