[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56411.1

[Show Plain Result]


## Summary of Sequence Search
    1::407
    1::117     7e-06  28%  122 aa  PF06030 DUF916 "Bacterial protein of unknown function (DUF916)"
    1::407

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWSVAPSNENGELGRSYFVH
PF06030         ---------------------------------------------------FSVTPVLPENQIDKSYFDL


                         .         .         *         .         .         .         .:140
query           DVKPGQTIEDWVAITNYGEEPMTFSVYGTDAFNTPDGSFXXXXXXXXXXXXGTWIEIPREDQTVEVKGGE
PF06030         KVKPGQTQTLKVRVTNNTDKEITVEVYANDATTNDNGVIDTKKDKSLKYPLSDLVKFPKEEVTLPANSSK


                         +         .         .         .         .         *         .:210
query           TRVIPFTITVPDNAEPGDHAAGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06030         T--VTFTVKMPKEAFDGVILGGI-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06030         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06030         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06030         ---------------------------------------------------------