[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56580.1

[Show Plain Result]


## Summary of Sequence Search
    1::385
    3::169     7e-25  40%  171 aa  PF02222 ATP-grasp "ATP-grasp domain"
    1::104     8e-05  29%  207 aa  PF02786 CPSase_L_D2 "Carbamoyl-phosphate synthase L chain, ATP
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02222         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
PF02222         ----------------------------------------------ELGLPTAPYRFVDSLEELRAAVAE
PF02786         ------------------------------------DKDRFKELMKKAGVPVPPGSIATSVEEALEAAEE


                         +         .         .         .         .         *         .:210
query           TGWPVVLKAARGGYDGKGVWVVGDXXXXXXXXXXXXXXQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
PF02222         LGYPCVLKTPRGGYDGKGQSVVRSEEDLEAAWDYAGGG--PVIVEEFVPFDREISVLVARSVDGETVFYP
PF02786         IGYPVIVKPSYGG-GGRGMRIVYEEALREALAESPAFGNDPVLIEKFLEGARHIEVQVLRDGHGNV----


                         .         .         .         +         .         .         .:280
query           VVETVQRGGICHEVIAPAPHLSEDRXXXXXXXXXXXXXXXXXXXXXXXELFETDTGVVVNELAMRPHNSG
PF02222         PVENIHEDGILRESWAPA-RISDALLEKAQEIARKIAEALGGVGVFGVELFVTDGDLLVNELAPRPHNSG
PF02786         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HWTIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02222         HWTIE-----------------------------------------------------------------
PF02786         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02222         -----------------------------------
PF02786         -----------------------------------