[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56592.1

[Show Plain Result]


## Summary of Sequence Search
    1::460
    2::270     1e-24  42%  275 aa  PF07992 Pyr_redox_2 "Pyridine nucleotide-disulphide oxidoreductase"
    1::109     3e-20  42%  110 aa  PF02852 Pyr_redox_dim "Pyridine nucleotide-disulphide
    2::92      9e-05  36%  391 aa  PF01134 GIDA "Glucose inhibited division protein A"
    1::66      1e-04  38%   78 aa  PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"
    1::30      6e-04  60%   78 aa  PF00070 Pyr_redox "Pyridine nucleotide-disulphide oxidoreductase"(query 3->32)
    1::460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
PF07992         ---VVIIGGGPAGLAAALRLARAGLKVTLIEREPGGG-----------------------------GLNR
PF02852         ----------------------------------------------------------------------
PF01134         ---VIVIGGGHAGCEAALAAARMGAKTLLLTHDTIGEMS----CNPS---IGGIAKGHLVREIDALGGLM
PF00070         ----------------------------------------------------------------------
PF00070         --KVAVVGGGPAGLEAAGVLARLGHKVTLVER--------------------------------------


                         .         .         *         .         .         .         .:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
PF07992         GGIPSKPLLKAAEVGELDLRL--LEQAKD---------RGVEVLLGEVTGIDPEVTLADGETIEADAVVL
PF02852         ----------------------------------------------------------------------
PF01134         GRAADKTGIQFRMLNTSKGPAVRALRAQA-----------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
PF07992         ATGARPRPIPGEELPGVGVLTSDDALELRGKPKRVVVVGGGNTGLELAGALARLGAEVTVVERRRRLLPA
PF02852         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         ---------------------------------KVAVVGGGPAGLEAAGVLARLGHKVTLVERRDRLGPQ
PF00070         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
PF07992         LDAEEAAALAAELLKGG-GALAETEVEGVDGVVGGVVVKVVTGEEEEVDADLVAVGRGGVPPNLLLEAAG
PF02852         ----------------------------------------------------------------------
PF01134         ----------------------------------------------------------------------
PF00070         LDEEISKYLQERLEKLGVEVRLNTRVTEV-----------------------------------------
PF00070         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVASTVFTHP
PF07992         LELDERGRIVVDETLQTSVPGVFAAGD-------------------------------------------
PF02852         -------------------------------------------------------------IPSVVFTDP
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
PF07992         ----------------------------------------------------------------------
PF02852         EIASVGLTEEEAKAAGIDIKVGKFPFKANGRALAMGETEGFVKLVFDKETGRILGAHIVGPGAGELIQEL
PF01134         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAxxxxxxxxxx
PF07992         ----------------------------------------
PF02852         ALAIKMGATVEDLALTIHYHPTLSEALVEA----------
PF01134         ----------------------------------------
PF00070         ----------------------------------------
PF00070         ----------------------------------------