[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56646.1

[Show Plain Result]


## Summary of Sequence Search
    1::169
   14::121     1e-16  44%  121 aa  PF00380 Ribosomal_S9 "Ribosomal protein S9/S16"
    1::169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGTGEWKING
PF00380         ------------------------------------------------------------PGTGKITING


                         .         .         *         .         .         .         .:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
PF00380         KPLEEYFPRETLREKVLEPLLLTGTLGKFDIRVRVKGGGLTGQAGAIRHGIARALVAYDPDL-RPELKKA


                         +         .         .         .         .         *         .:210
query           GFLTRDARKVEXXXXXXXXXXXXPQYSKR
PF00380         GLLTRDPRRVERKKYGLKKARKRPQFSKR