[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ56713.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    5::102     1e-10  52%  112 aa  PF09557 DUF2382 "Domain of unknown function (DUF2382)"
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09557         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEERARIG
PF09557         ---------------------------------------------------------------EERLVVG


                         +         .         .         .         .         *         .:210
query           VERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTGEEQAAATDRIGEQDQEITLHEERAVVGKEE
PF09557         KERVKTGEVRVRKEVVTETVTVEVPVRREEVVVERVPVDDEVAAAPAEDFEEETIEIPLSEERAVVTKET


                         .         .         .         +         .         .         .:280
query           VPVERVRISKEEVTDTERVKxxxxxxxxxxxxxxxxxx
PF09557         VVVEEVRVRKETVTETETVE------------------