[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for tfus0:AAZ57003.1

[Show Plain Result]


## Summary of Sequence Search
    1::792
    5::378     e-143  62%  378 aa  PF09364 XFP_N "XFP N-terminal domain"
    1::202     4e-87  71%  203 aa  PF09363 XFP_C "XFP C-terminal domain"
    1::179     1e-78  74%  179 aa  PF03894 XFP "D-xylulose 5-phosphate/D-fructose 6-phosphate
    1::792

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
PF09364         ---------------ELEKLDAYWRAANYLSVGQIYLRDNPLLKEPLKAEDIKPRLLGHWGTTPGLNFVY
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
PF09364         AHLNRLIKKYDLDMIYITGPGHGGPAIVANSYLEGSYSEFYPEISQDEEGLQRLFKQFSFPGGIPSHVAP
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLXXXXXXXXXXXXXXXLSGSWQSIRFLNPARDGAVLPILHLN
PF09364         ETPGSIHEGGELGYALSHAYGAVLDNPDLIVACVVGDGEAETGPLATSWHSNKFLNPATDGAVLPILHLN
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
PF09364         GYKIANPTILARISDEELEALFRGYGYDPYFVEGDDPAAMHQAMAAALDTALEEIRAIQ-KAARSGGDAE
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
PF09364         RPRWPMIILRTPKGWTGPKEVDGKKIEGSWRAHQVPLPNARDDPEHLKLLEDWLRSYKPEELFDEDGRLI
PF09363         ----------------------------------------------------------------------
PF03894         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PEXXXXXXXXDCRISSSPHANGGXXXXXXXXPDFRDYAVExxxxxxxxxxxTRVLGGFLRDVVAANPHNF
PF09364         PELKALAPKGDRRMGANPHANGGLLRRDLKLPDFRDYAVE------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         ---------------------------------------------------TRVLGKYLRDVIKLNPDNF


                         .         .         +         .         .         .         .:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         RIFGPDETASNRLQAVFEVTKRQWMAEILPPDDDYAPGGRVMEPLSEHACEGWLEGYLLTGRHGLFASYE


                         *         .         .         .         .         +         .:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------------------------------------------------
PF03894         AFAHVVDSMLNQHAKWLKVTAEAPWRRPIPSLNYLLTSHVWRQDHNGFSHQDPGFIDHVANKMPNVVRVY


                         .         .         .         *         .         .         .:630
query           LPPDCNTLLCTMDHCLRSxxxxxxxxxxKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
PF09364         ----------------------------------------------------------------------
PF09363         ----------------------------KQPTPQWLSMDEAIKHCTAGAGIWDWASTDQGEEPDVVLACA
PF03894         LPPDANSLLAVYDHCLRT----------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVDLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWL
PF09364         ----------------------------------------------------------------------
PF09363         GDEPTLEALAAADLLREHFPELKIRVVNVVDLMKLQPPSEHPHGLSDEEFDSLFTTDKPVIFAFHGYPWL
PF03894         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IHRLTYRRAGHPNLHVRGYKEEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDERLR
PF09364         ----------------------------------------------------------------------
PF09363         IHRLTYRRPNHRNFHVRGYKEEGTTTTPFDMVVLNGLDRFHLAIDAIDRVPRLGDKAAELRQEMDDKLIE
PF03894         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           CRAYTRQYGEDAPDIRNWVWxx
PF09364         ----------------------
PF09363         HRQYIREHGEDPPEIRDWKW--
PF03894         ----------------------