[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54134.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7jA.bssp"
#ERROR : Can't open dsspfile "1u0kA1.bssp"
#ERROR : Can't open dsspfile "1t6kA1.bssp"
#ERROR : Can't open dsspfile "1t6kA2.bssp"
#ERROR : Can't open dsspfile "1qy9A2.bssp"
#ERROR : Can't open dsspfile "1qy9A1.bssp"
#ERROR : Can't open dsspfile "1u0kA2.bssp"
#ERROR : Can't open dsspfile "2edmA1.bssp"
#ERROR : Can't open dsspfile "1bwzA1.bssp"
#ERROR : Can't open dsspfile "1to6A.bssp"
#ERROR : Can't open dsspfile "2fug21.bssp"

## Summary of PDB Search
:267
    5e-69  43%  1s7jA  [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF FAMILY
    9e-26  21%  1u0kA1 [d.21.1.2] GENE PRODUCT PA4716 A:2 -- 130
    1e-22  26%  1t6kA1 [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF A:1 -- 128
    2e-21  27%  1t6kA2 [d.21.1.2] PHENAZINE BIOSYNTHESIS PROTEIN PHZF A:129 -- 278
    1e-20  28%  1qy9A2 [d.21.1.2] HYPOTHETICAL PROTEIN YDDE A:130 -- 297
    7e-20  31%  1qy9A1 [d.21.1.2] HYPOTHETICAL PROTEIN YDDE A:3 -- 129
    1e-19  20%  1u0kA2 [d.21.1.2] GENE PRODUCT PA4716 A:131 -- 283
    6e-19  15%  2edmA1 [b.170.1.1] 22KDA STRUCTURAL PROTEIN VP22 A:41 -- 201
    3e-12  17%  1bwzA1 [d.21.1.1] PROTEIN (DIAMINOPIMELATE EPIMERASE) A:1 -- 130
    7e-07   6%  1to6A  [c.141.1.1] GLYCERATE KINASE
    2e-05  17%  2fug21 [c.47.1.21] NADH-QUINONE OXIDOREDUCTASE CHAIN 2 2:3 -- 180
:267

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
1s7jA           ---YYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKE---GQSYALRWFTPEREI
1u0kA1          --RYWQLDVFAERPLTGNGLAVFDDASALDDAAXQAWTRELRQFESIFLLPGDD-PRAFRARIFTLEEEL
1t6kA1          MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVLK-PRNGGDALIRIFTPVNEL
1t6kA2          ----------------------------------------------------------------------
1qy9A2          ----------------------------------------------------------------------
1qy9A1          --QVYHVDAFTSQPFRGNSAGVVFPADNLSEAQXQLIARELGHSETAFLLHS--DDSDVRIRYFTPTVEV
1u0kA2          ----------------------------------------------------------------------
2edmA1          --RAKVMSIRGERSY-NTPLGKVAMKNGLSDKDMKDVSADL--VISTVTAPRTDPASNMTLKILNNTGVD
1bwzA1          ---------FSKMHGLGNDFVVVDGNVFFTPETIRRLANRHGFDQLLIVEAPYDPELDFHYRIFNADSEV
1to6A           -LGKIPLEKRNPLQIQTRGIGELIRHLI--SQEIKEIYIGVGGTASNDGGI--GIAAGLGYQFYDEDNAL
2fug21          -----LEETFAKYPPEGRRAAIMLLRRVQQPERIEEIARLVGTTPTEVMGV--ASFYSYYQFVPTGKYHL


                         .         .         *         .         .         .         .:140
query           DLCXXXXXXXXXXXXXXXXXXPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
1s7jA           DLCGHATLATAFVLFNYYSVAELHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEA
1u0kA1          PFAGHPLLGAAALLHHLRGGDNLHLASKSVALRSVRAGSGFYAEXDQGRA--------------------
1t6kA1          PFAGHPLLGTAIALGAHTDNHRLYLETQMGTIAFELERIAASMDQPI-----------------------
1t6kA2          -------------------------------------------------------DAELLKALGDSTFPI
1qy9A2          ------------------------------------------------------------DILPGLPIQV
1qy9A1          PICGHATVAAHYVRAKVLGLGNIWQTSLAGKHRVTIENDDYRISLEQGTP--------------------
1u0kA2          ------------------------------------------------------TCRWFAEAFSLSANDL
2edmA1          LLI-------------------------------------------------------------------
1bwzA1          SQCGNGARCFARFVTLKGLTNKISVSTQKGNMVLTVKDMRVNMGEPIWEP--AKIP--------------
1to6A           PACGQSLLNLASVSTENRYKIPVHIRILADVVSPLCGQGATYTFGKQKGLDSTMFE--------------
2fug21          QVC-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
1s7jA           YLG--RDLFFVLKDEETVAKITPDFSALKALDLGGVIVTASGDS---VDFVSRTFFPKLRINEDPVCGSA
1u0kA1          ----------------------------------------------------------------------
1t6kA1          ----------------------------------------------------------------------
1t6kA2          EIYHNGHVFVGLPSIDALSALHPDHRALSNFHDMAINCFAGA----GRRWRSRMFSPAYGVVEDAATGSA
1qy9A2          ATTGHSKVXIPLKPEVDIDALSPDLNALTAISKKGCNGFFPFQIPGKNETDGRXFSPAIGIVEDPVTGNA
1qy9A1          ----------------------------------------------------------------------
1u0kA2          SPRVVSYLLLPVTAEALGRARQVNQEALDKLGAAFVYLLDV-------DGREGRTWDNLGLVEDVATGSA
2edmA1          ----------------------------------------------------------------------
1bwzA1          ----------------------------------------------------------------------
1to6A           ----------------------------------------------------------------------
2fug21          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRx
1s7jA           HANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEV---KENRVIIGGTAKLFAKGEA--
1u0kA1          ---------------------------------------------------------
1t6kA1          ---------------------------------------------------------
1t6kA2          AGPLAIHLARHGQIEFGQPVEILQRPSLMFAKARAEQLTRVEVSGNGVTFGRGTIV-
1qy9A2          NGPXGAWLVHHGNVLRVKGHQGRALGREVTVTIRDNQPEKVTISGTAVILFHAEWA-
1qy9A1          ---------------------------------------------------------
1u0kA2          AGPVAAYLVEAARGEPFVLHQGRFRPSRLDVQVATD--GSVRVGGHVQLLARAEL--
2edmA1          ---------------------------------------------------------
1bwzA1          ---------------------------------------------------------
1to6A           ---------------------------------------------------------
2fug21          ---------------------------------------------------------