[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54138.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oceA3.bssp"
#ERROR : Can't open dsspfile "2oceA5.bssp"
#ERROR : Can't open dsspfile "1wlqC.bssp"
#ERROR : Can't open dsspfile "2oceA2.bssp"
#ERROR : Can't open dsspfile "1tiwA1.bssp"
#ERROR : Can't open dsspfile "3ci0K2.bssp"
#ERROR : Can't open dsspfile "2i5hA1.bssp"
#ERROR : Can't open dsspfile "2oceA1.bssp"
#ERROR : Can't open dsspfile "2eduA1.bssp"
#ERROR : Can't open dsspfile "2axtU1.bssp"
#ERROR : Can't open dsspfile "2a1jB1.bssp"
#ERROR : Can't open dsspfile "1x2iA1.bssp"
#ERROR : Can't open dsspfile "1c7yA2.bssp"
#ERROR : Can't open dsspfile "1nmnA.bssp"
#ERROR : Can't open dsspfile "2duyA1.bssp"
#ERROR : Can't open dsspfile "1hjrA.bssp"
#ERROR : Can't open dsspfile "1iv0A.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "1bvsA2.bssp"
#ERROR : Can't open dsspfile "1bpdA1.bssp"
#ERROR : Can't open dsspfile "1bmfD1.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1vhxA.bssp"
#ERROR : Can't open dsspfile "2aa4A1.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "1u9lA.bssp"
#ERROR : Can't open dsspfile "2p3rA1.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2ch5A2.bssp"

## Summary of PDB Search
:777
    4e-99  53%  2oceA3 [a.294.1.1] HYPOTHETICAL PROTEIN PA5201 A:2 -- 324
    3e-34  69%  2oceA5 [c.55.3.13] HYPOTHETICAL PROTEIN PA5201 A:325 -- 473
    8e-33  12%  1wlqC  [a.4.5.52] CDT1 PROTEIN
    1e-27  68%  2oceA2 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:564 -- 636
    9e-26  20%  1tiwA1 [a.176.1.1] BIFUNCTIONAL PUTA PROTEIN A:89 -- 261
    1e-25  12%  3ci0K2 [a.60.16.1] PSEUDOPILIN GSPK K:94 -- 203
    2e-21  12%  2i5hA1 [e.71.1.1] HYPOTHETICAL PROTEIN AF1531 A:16 -- 195
    5e-21  73%  2oceA1 [a.60.2.6] HYPOTHETICAL PROTEIN PA5201 A:474 -- 563
    2e-19  24%  2eduA1 [a.60.2.7] KINESIN-LIKE PROTEIN KIF22 A:8 -- 98
    7e-18  16%  2axtU1 [a.60.12.2] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN U:37 --
    5e-12  17%  2a1jB1 [a.60.2.5] DNA EXCISION REPAIR PROTEIN ERCC-1 B:219 -- 296
    2e-11  14%  1x2iA1 [a.60.2.5] HEF HELICASE/NUCLEASE A:2 -- 69
    3e-11  17%  1c7yA2 [a.60.2.1] HOLLIDAY JUNCTION DNA HELICASE RUVA A:65 -- 150
    4e-11  14%  1nmnA  [c.55.3.8] HYPOTHETICAL PROTEIN YQGF
    2e-09  36%  2duyA1 [a.60.2.7] COMPETENCE PROTEIN COMEA-RELATED PROTEIN A:11 --
    2e-09  14%  1hjrA  [c.55.3.6] HOLLIDAY JUNCTION RESOLVASE (RUVC)
    9e-09  14%  1iv0A  [c.55.3.8] HYPOTHETICAL PROTEIN
    1e-08   8%  1jjgA  [b.40.4.5] M156R
    2e-08  30%  1bvsA2 [a.60.2.1] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
    2e-08  15%  1bpdA1 [a.60.6.1] DNA POLYMERASE BETA A:9 -- 91
    4e-07  14%  1bmfD1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE D:358 -- 475
    9e-07  18%  1kftA  [a.60.2.3] EXCINUCLEASE ABC SUBUNIT C
    4e-06  23%  1vhxA  [c.55.3.8] PUTATIVE HOLLIDAY JUNCTION RESOLVASE
    7e-06  18%  2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
    2e-05  41%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730
    3e-05   8%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151
    9e-05  15%  1u9lA  [a.60.4.2] TRANSCRIPTION ELONGATION PROTEIN NUSA
    2e-04  26%  2p3rA1 [c.55.1.4] GLYCEROL KINASE A:2 -- 253
    3e-04  19%  1sroA  [b.40.4.5] PNPASE
    4e-04  17%  2ch5A2 [c.55.1.5] NAGK PROTEIN A:1 -- 117
:777

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIXXXXXXXXXXXXXXT
2oceA3          ---SINTRIAEELSALPSGRAAAVALLDEGSTVPFIARYRKEVTGSLDDTQLRMLEERLRYLRELEERRG
2oceA5          ----------------------------------------------------------------------
1wlqC           --------------------------------APAYQRFHALAQPGLPGLVLP---YKYQVLVEXFHSXD
2oceA2          ----------------------------------------------------------------------
1tiwA1          ---------------------------------------------------------------------T
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
2oceA3          AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIALEAGLGALADALFDDPTLVPESE
2oceA5          ----------------------------------------------------------------------
1wlqC           TIVSXLHNRSETVAKVKQGVQEXXRKRFEERNVGQIKTVYPXSYRFRQECNVPTFKDSIKRSDYQTIEPL
2oceA2          ----------------------------------------------------------------------
1tiwA1          EAVSMLLEQARLPQPVAEQAHKL-AYQLADKLRNQKNASGRAGMGVA----LMCLAEALL----RIPDKA
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
2oceA3          AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH
2oceA5          ----------------------------------------------------------------------
1wlqC           LGQEGATQLTATCLLQRRQVFRQNLVERVKE--QHKVFLASLNPPXAVPDDQLTR---------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          TRDALIRDSGEPLIRKGVDMAMRLMGEQF-----------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLXXXXXXXXXXXXSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
2oceA3          DEPLKSAPSHRALAIFRGRNEGVLSASL--KVGEEAPGTLHPCEVMIAERFGLSNQGRAADKWLAEVVRW
2oceA5          ----------------------------------------------------------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
2oceA3          TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAA-----------------------------
2oceA5          -----------------------------------------PAGPRATLGLDPGLRTGVKVAVVDATGKL
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           --------------------------------------------SGTLLAFDFGTKS-IGVAVGQRITG-
2duyA1          ----------------------------------------------------------------------
1hjrA           ------------------------------------------------LGIDPGSRV-TGYGVIRQVGRQ
1iv0A           ------------------------------------------------GALDVGEAR-IGLAVGEEGVPL
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ------------------------------------------------LGLDLGTKT-LGVALSDEXGWT
2aa4A1          -----------------------------------------------TLAIDIG-GTKLAAALIGADGQI
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ------------------------------------------------VALDQG-TTSSRAVVMDHDANI
1sroA           ----------------------------------------------------------------------
2ch5A2          ------------------------------------------------GGVEGG-GTRSEVLLVSEDGKI


                         .         .         .         .         *         .         .:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMXXXXX
2oceA3          ----------------------------------------------------------------------
2oceA5          LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           --TARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANR-----------
2duyA1          ----------------------------------------------------------------------
1hjrA           LGSGCIRTKVLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNAD--SALKLGQARGVAIVAAVNQELP
1iv0A           A---SGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGDLKESAQAGLPLVEALRAR--------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           AGIETIKINEAEGDYG--LSRLSELIKDYTIDKIVLGNGTVGPRGEQTFAKVLETTYNVPVVLW------
2aa4A1          RDRRE-LPTPASQTPEALRDALSALVSPLQAHAQRVAIAST-----------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ISVSQIYPHDPMEIWATQSSTLVEVLAKADISSDQI----------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          LLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR--------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
2oceA3          ----------------------------------------------------------------------
2oceA5          ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQ--------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------LNALATTASRPLAVQQLIALISRLDVPAYRAELIAE
2i5hA1          ------------NFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAVIEHIIKQDEK
2oceA1          --------------------------------------------------YQHDVSQLKLARSLDAVVED
2eduA1          -------------------------------------------------EKAEDCWELQI---SPELLAH
2axtU1          ----------------------------------------------------------------------
2a1jB1          --------------------------------------------------------------------DL
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           VFEYAARQVKQTVVGIGSAEKSQVQHMVRTLKLP------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
2oceA3          ----------------------------------------------------------------------
2oceA5          ----------------------------------------------------------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          SL----WEFIDEDRSVQTRLGREDSEYLARSVPFYAANQPLADISEMRVVQGMDAGLYQKLKPLVCALPM
2i5hA1          KYVDFFNDSITTRMHQLELLPGVGKKMMWAIIEERK-KRPFESFEDIAQRVKGIQRPEKLIRIIYEIKNP
2oceA1          CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG
2eduA1          GRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMELKANILGLAAG
2axtU1          ------IDLNNTNIAAFIQYRGLYPTLAKLIVKN----APYESVEDVLNIPGLTERQKQILRENLEHFTV
2a1jB1          LMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGEQLIAASREDLALCPGLGPQKARRLFDVLHEP--
1x2iA1          ------LTLAERQRLIVEGLPHVSATLARRLLKHFGSVERVFSVAELMKVEGIGEKIAKEIRRVITAPYI
1c7yA2          ---------------ELIKTNGVGPKLALAILSGMSAQQFVNEVGALVKLPGIGKKTAERLIVEMKDRFK
1nmnA           ----------------------------------------------------------------------
2duyA1          ------VSLNEASLEELXALPGIGPVLARRIVEGR----PYARVEDLLKVKGIGPATLERLRPYLR----
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1bvsA2          ---------------ALLSVSGVGPRLAMATLAVHDAAALRQDVASLTRVPGIGRRGAERIVLELADKVG
1bpdA1          -SVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLA-TGKLRKLEKIRQ---------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------LETIEGVGPKRRQMLLKYMGGLQGLRSVEEIAKVPGISQGLAEKIFWSLK----
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           -----------AAIDTFTKYLDIDEDFATVLVESTLEELAYVPMKELLEIEGLDEPTVEALRERAK----
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
2oceA3          ----------------------------------------------------------------------
2oceA5          ----------------------------------------------------------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP
1tiwA1          ----------------------------------------------------------------------
3ci0K2          T---------------------------------------------------------------------
2i5hA1          QTKY------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          TEVETALVEGGDRY--------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          E---------------------------------------------------------------------
1c7yA2          GLHGDLFTPAADLVLT------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           --------------------------------------------------------------VIKPSSRP
1bvsA2          P---------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ---MDPNIVGSEHYDVARGVQKILQDY-----------------------KSLQDIIAILGMDELSEEDK
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNXXXXXXXXXXXXXXXXXXXXSAMSKSFVKDPRDVVKPGD
2oceA3          ----------------------------------------------------------------------
2oceA5          ----------------------------------------------------------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          RPE-------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           RPRKNKNIKVNTYRTSAMDLSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDTLDRLKEVGR
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          LTVSRARKIQRFLSQ--PFQVAEVFTGHLGKPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKAD
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          ---FKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD
2ja9A1          -------------------SVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGD
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           -----------------EIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQ
2ch5A2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IXXXXXXXXXXXXXXISLTLRLDDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oceA3          ----------------------------------------------------------------------
2oceA5          ----------------------------------------------------------------------
1wlqC           ----------------------------------------------------------------------
2oceA2          ----------------------------------------------------------------------
1tiwA1          ----------------------------------------------------------------------
3ci0K2          ----------------------------------------------------------------------
2i5hA1          ----------------------------------------------------------------------
2oceA1          ----------------------------------------------------------------------
2eduA1          ----------------------------------------------------------------------
2axtU1          ----------------------------------------------------------------------
2a1jB1          ----------------------------------------------------------------------
1x2iA1          ----------------------------------------------------------------------
1c7yA2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2duyA1          ----------------------------------------------------------------------
1hjrA           ----------------------------------------------------------------------
1iv0A           ----------------------------------------------------------------------
1jjgA           V---------------------------------------------------------------------
1bvsA2          ----------------------------------------------------------------------
1bpdA1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1vhxA           ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2oceA4          IVKVKVMEVDIPRNRVGLSMR-------------------------------------------------
2ja9A1          L-VYARVCTAEKELEAEIECFDSTT---------------------------------------------
1u9lA           ----------------------------------------------------------------------
2p3rA1          ----------------------------------------------------------------------
1sroA           E---------------------------------------------------------------------
2ch5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxx
2oceA3          -------
2oceA5          -------
1wlqC           -------
2oceA2          -------
1tiwA1          -------
3ci0K2          -------
2i5hA1          -------
2oceA1          -------
2eduA1          -------
2axtU1          -------
2a1jB1          -------
1x2iA1          -------
1c7yA2          -------
1nmnA           -------
2duyA1          -------
1hjrA           -------
1iv0A           -------
1jjgA           -------
1bvsA2          -------
1bpdA1          -------
1bmfD1          -------
1kftA           -------
1vhxA           -------
2aa4A1          -------
2oceA4          -------
2ja9A1          -------
1u9lA           -------
2p3rA1          -------
1sroA           -------
2ch5A2          -------