[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54436.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j6oA.bssp"
#ERROR : Can't open dsspfile "1zzmA1.bssp"
#ERROR : Can't open dsspfile "1xwyA1.bssp"
#ERROR : Can't open dsspfile "1yixA1.bssp"
#ERROR : Can't open dsspfile "2f6kA1.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "1m7jA3.bssp"
#ERROR : Can't open dsspfile "1m65A.bssp"
#ERROR : Can't open dsspfile "1gkpA2.bssp"
#ERROR : Can't open dsspfile "2dvtA1.bssp"
#ERROR : Can't open dsspfile "2hbvA1.bssp"
#ERROR : Can't open dsspfile "1a4lA.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"

## Summary of PDB Search
:306
    6e-48  29%  1j6oA  [c.1.9.12] TATD-RELATED DEOXYRIBONUCLEASE
    1e-34  27%  1zzmA1 [c.1.9.12] PUTATIVE DEOXYRIBONUCLEASE YJJV A:1 -- 259
    3e-31  29%  1xwyA1 [c.1.9.12] DEOXYRIBONUCLEASE TATD A:1 -- 260
    2e-21  34%  1yixA1 [c.1.9.12] DEOXYRIBONUCLEASE YCFH A:1 -- 265
    3e-11  12%  2f6kA1 [c.1.9.15] METAL-DEPENDENT HYDROLASE A:2 -- 307
    9e-10  17%  1dpmA  [c.1.9.3] PHOSPHOTRIESTERASE
    1e-08   6%  1m7jA3 [c.1.9.11] D-AMINOACYLASE A:62 -- 419
    3e-07  11%  1m65A  [c.6.3.1] HYPOTHETICAL PROTEIN YCDX
    4e-07   9%  1gkpA2 [c.1.9.6] HYDANTOINASE A:55 -- 389
    2e-06  12%  2dvtA1 [c.1.9.15] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE A:1 --
    2e-05  14%  2hbvA1 [c.1.9.15] 2-AMINO-3-CARBOXYMUCONATE 6-SEMIALDEHYDE A:3 --
    4e-05  10%  1a4lA  [c.1.9.1] ADENOSINE DEAMINASE
    8e-05  21%  1bf6A  [c.1.9.3] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
:306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
1j6oA           ---------------------------------DTHAHLHFHDDDRNAVISSFEENNIEFVVNVGVNLED
1zzmA1          ---------------------------------DTHCHFDFPPGDEEASLQRAAQAGVGKIIVPATEAEN
1xwyA1          ---------------------------------DIGVNLTSSQKDRDDVVACAFDAGVNGLLITGTNLRE
1yixA1          ---------------------------------DSHCHLDGLDYDVDDVLAKAAARDVKFCLAVATTLPS
2f6kA1          ---------------------------------DFHTHYLPTSWTPQLTLNFXRDNDISYSILSLSSPHV
1dpmA           ----------------------------------------------------------------------
1m7jA3          ----------------------------------------------------------------------
1m65A           ---------------------------------DLHMHTVASTSTLSDYIAQAKQKGIKLFAITDHGPDM
1gkpA2          ---------------------------------DPHVHIYLMATFAKDTHETGSKAALMGGTTTYIEMCC
2dvtA1          ----------------------------------------------------------------------
2hbvA1          ---------------------------------GKNNFRPVYQADPAFRIEEMDAQGVDVQVTCATPVMF
1a4lA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCA
1j6oA           SKKSLDLSKTSDRIFCSVGVHPHDAKE------VPEDFIEHLEKFAKDE-----------------KVVA
1zzmA1          FARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPA---------------------KVVA
1xwyA1          SQQAQKLARQYSSCWSTAGVHPHDS--SQWQAATEEAIIELAAQP---------------------EVVA
1yixA1          YLHMRDLVGERDNVVFSCGVHPLNQNDPYDVEDLRRL-------------------------AAEEGVVA
2f6kA1          NFGDKAETIRNDDGKSLAQQYPDQLGYLASLPIPYELDAVKTVQQA---------------------LDQ
1dpmA           ------------------------------------------------------------------IQYG
1m7jA3          ----------------------------------------------------------------------
1m65A           EDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD----------------------GEIDCSGKMFDS
1gkpA2          PSRNDDALEGYQLWKSKAEGNSYCDYTFHMAVSKFDEK----------------------TEGQLREIVA
2dvtA1          ------------------------------------------------------------------GFVG
2hbvA1          GYTWQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEAS----------------------RAVA
1a4lA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
1j6oA           IGETGLDFFRN-ISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPERGVIHAFSSDY
1zzmA1          VGEIGLDLFGDDPQ-FERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSL
1xwyA1          IGECGLDFNRNFS-TPEEQERAFVAQLRIAADLNMPVFMHCRDAHERFMTLLEPWLDKLPAVLHCFTGTR
1yixA1          LGETGLDYYYTP-ETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCGVLHCFTEDR
2f6kA1          DGALGVTVPTNS-RGLYFGSPVLERVYQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGFFXINXLKY
1dpmA           IEDTGIRAGITTGKATPFQELVLKAAARASLATGVPVTTHTQRDGEQQAAIFESEGLSPSCIGHSDDTDD
1m7jA3          ------------------LIEAAMASQDVSLDAYPYVAGSTMLKQDRVLLAGRTLITWCKPPELSGRDLE
1m65A           LDLIIAGFHEPVFAPHDKATN-TQAMIATIASGNVHIISHPGNPKYEIDKAVAEAAAKHQVAINNSSNCR
1gkpA2          DGISSFXIFLSYKNFFGVDDGEMYQTLRLAKELGVIVTAHCENAELVGRLQQKLLSEGKTGEWHEPSRPE
2dvtA1          ALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPWLLGILGHMGEGLP
2hbvA1          AGHLGIQIGNHL-GDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMAFERIPKSLKICFGHGGGSF
1a4lA           ----------------------HVEAYEGAVKNGIHRTVHEVGSPEVVREAVDILKTERVGHGYHTIEDE
1bf6A           IAEIG-----TSEGKITLEEKVFIAAALAHNQTGRPISTHFSTMGLEQLALLQAHGVLSRVTVHCLKDNL


                         .         .         .         +         .         .         .:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRAL
1j6oA           EWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETI
1zzmA1          QQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVL
1xwyA1          EEMQACVAHGIYIGITGWVDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTSRRNEPAHLPHILQRI
1yixA1          ETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYM
2f6kA1          HFFEKYPNIKVIIPHAGAAGAVLPRQLPTLXSLAQPEHLLYGSDIPYTPLDG----------SRQLGHAL
1dpmA           LYLTALAARGYLIGLDHIPHSAIALLIKALIDQGYMKQILVSNDWLFGFSSYVVMDRVNPDGMAFRVIPF
1m7jA3          EIAAERGKSKYDVVPELQPAGAIYFMMDEPDVQRILAFGPTMIGSDGLPHDERPHPRLWGTFPRVLGHYS
1m65A           EVAAAVRDAGGWVALGSDSHTAFTMGEFEDAVDFPPERILNVSPRRLLNFLESRGMAPIA----------
1gkpA2          AVEAEGTARFATFLETTG----------------------------------------------------
2dvtA1          YMMWRIDHRNAWVKLPPRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADTDWPFENIDHASDW
2hbvA1          AFLLGRVDNAYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQK-------------IGGL
1a4lA           ALYNRLLKENMHFEVCPWSSYLTGAWDPK-----TTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMT
1bf6A           DNILKMIDLGAYVQFIGKNSYYPDEKLRDRGLLNRVMLSMDITRRSHLKANGGYGY---DYLLTTFIPQL


                         .         *         .         .         .         .         +:350
query           AELKGMAEDELAETVAANARRAFALP
1j6oA           SQVLGVPEAKVDEATTENARRIF---
1zzmA1          CELRREPADEIAQALLNNTYTLFNVP
1xwyA1          AHWRGEDAAWLAATTDANVKTLFGI-
1yixA1          AVLKGVAVEELAQVTTDNFARLFHID
2f6kA1          ATTDLLTNEQKQAIFYDNAHRLL---
1dpmA           LREKGVPQETLAGITVTNPARFLSP-
1m7jA3          RDLGLFPLETAVWKMTGLTAAKFGLA
1m65A           --------------------------
1gkpA2          --------------------------
2dvtA1          FNATSIAEADRVKIGRTNARRLFKL-
2hbvA1          VLSSNLGESAKDKIISGNASKFFNI-
1a4lA           KKDMGFTEEEF-KRLNINAAKSSFLP
1bf6A           RQ-SGFSQADVDVMLRENPSQFF---