[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tfus0:AAZ54441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ddbA.bssp"
#ERROR : Can't open dsspfile "1w3bA.bssp"
#ERROR : Can't open dsspfile "1hz4A.bssp"
#ERROR : Can't open dsspfile "2a5yB3.bssp"
#ERROR : Can't open dsspfile "1qsaA1.bssp"
#ERROR : Can't open dsspfile "1ya0A1.bssp"
#ERROR : Can't open dsspfile "1a87A.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1d8dA.bssp"
#ERROR : Can't open dsspfile "2fbnA1.bssp"
#ERROR : Can't open dsspfile "1fchA.bssp"
#ERROR : Can't open dsspfile "2pqnA1.bssp"
#ERROR : Can't open dsspfile "2cptA1.bssp"
#ERROR : Can't open dsspfile "2hr2A1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1qvrA2.bssp"
#ERROR : Can't open dsspfile "3ck7A1.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "2hr2A1.bssp"

## Summary of PDB Search
:1523
    3e-13   9%  1ddbA  [f.1.4.1] PROTEIN (BID)
    4e-13  14%  1w3bA  [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
    3e-10  15%  1hz4A  [a.118.8.2] MALT REGULATORY PROTEIN
    7e-10  22%  2a5yB3 [c.37.1.20] CED-4 B:109 -- 385
    2e-08   7%  1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70) A:1
    2e-07  10%  1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
    4e-06  10%  1a87A  [f.1.1.1] COLICIN N
    6e-06  16%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
    9e-06  11%  1d8dA  [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
    9e-05  13%  2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22 --
    9e-05  17%  1fchA  [a.118.8.1] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    1e-04   9%  2pqnA1 [a.118.8.1] MITOCHONDRIA FISSION 1 PROTEIN A:4 -- 129
    2e-04  18%  2cptA1 [a.7.14.1] VACUOLAR SORTING PROTEIN 4B A:8 -- 111
    2e-04  20%  2hr2A1 [a.118.8.8] HYPOTHETICAL PROTEIN A:2 -- 157
    3e-04  13%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    5e-04  37%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
    6e-04  12%  3ck7A1 [a.118.8.6] SUSD A:42 -- 551
    0.001  12%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
    5e-04  18%  2hr2A1 [a.118.8.8] HYPOTHETICAL PROTEIN A:2 -- 157(query 1127->1276)
:1523

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDIP
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ------------------------------------------------------------------GNVP
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQ
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          KQMTCY-IREYHVDRVIKKLMCDLDSFFLF---LHGRAGSGKSVIASQ-ALSKSDNYDSIVWLKDSGTAP
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          -------GRDEEI---RRVIQILLRRTKNNP-VLIGEPGVGKTAIVEGLAQR------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           IHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          KSTFDLFTDILLMLKSEDDLLNSVEHVTSVVLKRDRPNT--LFVFDDVVQEET----IRWAQELRCLVTT
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          RDISNAASQTCEFIEVTSLEIDECYDFLEAYGM-------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxQDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDSKQLAEATLSVWRE
1ddbA           ----------------------------------------------------------------------
1w3bA           -----QEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRH
1hz4A           ----------------------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          -------------------------------------------------------------------NTG
1ya0A1          ---------------------------------------------------------------------R
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           --------------------------------------------------RAEWADIDPVPQNDGPSPVV
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           KLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHD
1ddbA           ----------------------------------------------------------------------
1w3bA           AL-RLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQ-----YNPDLYCVRSDLGNL---LKALGRLEE
1hz4A           -------DTMHAEFNALRAAINDGN----PDEAERLAKLALEELPPGWFYSRIVATSVLEVLHCKGELTR
2a5yB3          ----------------------------------------------------------------------
1qsaA1          LVTVLAGQMPADYQTIASAIISLANNPNTVLTFARTT-----GATDFTRQM--------AAVAFASVARQ
1ya0A1          QAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYAAFKNQITTLQGQAKNRANPNRSEVQANLS
1a87A           ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1d8dA           QI-IYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWH
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
2hr2A1          ------VVGAYLALSDAQRQLVAGEYDEAAANCRRAXEISHTXPPEEAFDHAGFDAFCHAGLAEALAGLR


                         *         .         .         .         .         +         .:1260
query           SVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD
1ddbA           -----------------------------------------------------NGSGLGAKHITDLLVFG
1w3bA           AKACYLKAIE-----TQPNFAV---AWSNLGCVFNAQGEIWLAIHHFEKAVT-----LDPNFLDALGNVL
1hz4A           SLALMQQTEQMARQH--DVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVR
2a5yB3          ----------------------------------------------------------------------
1qsaA1          DAENARLMIPSLAQAQ-QLNEDQIQELRDIVAWRLMGNDVTDEQAKWRDDAIMRSQSTSLIERRVRMALG
1ya0A1          LFLEAASGFYLCTQSSS-CSYICQHCLVHLGDIARYRNQTSQAESYYRHA-----AQLVPSNGQPYN---
1a87A           ----------------------------------LVSGMGDKLGEYLGVKYNVAKEVANDIKNF------
1ihgA1          ----------------------------------------------------------------------
1d8dA           HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLEDVRNNSVWNQ--
2fbnA1          ----------------------------------------------------------------------
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          -------------------TDEGESGFYRTTFNCNLPTDECLWAWQKNQDIPQLTSIWSPSSQRTEWV--
1wfdA           ----------------------------------------------------------------------
2hr2A1          SFDEALHSADKALELNQDEGKLWISAVYSRALALDGLGRGAEAXPEFKKVVEXI-----EERK---GETP


                         .         .         .         *         .         .         .:1330
query           GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKD
1ddbA           FLQSSGCTRQEL-----EVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIAR
1w3bA           KEARIFDRAVAAYRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEK
1hz4A           IRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGKY
2a5yB3          ----------------------------------------------------------------------
1qsaA1          TGDRRGLNT-WLARLPMEAKEKDE-WRYWQADLLLERGREAEAKEI-------LHQLMQQYPMVAAQRIG
1ya0A1          QLAILASSKGDHLTTIFY--------YCRSIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKA
1a87A           -HGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFK---VADLAIKV
1ihgA1          ---GSGDSHPDFPEDADVDLKDVDKILLIS--------EDLKNIGNTFFKSQNWEMAIKKYTKVLRVEGS
1d8dA           -RHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNY--LKGILQDRGLSRYP-----NLLNQLLD
2fbnA1          --------IVKYKEALDFFIHTEEWDDQILLDKKKIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKN
1fchA           ----------------------------------------------------------------------
2pqnA1          ----------------------------------------------------------------------
2cptA1          ----------------------------------------------------------------------
2hr2A1          -------------------------------------------DAQRQLVAGEYDEAAAISHTXPPEEAF
1ouvA           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          -YVRLGYDITQYNFFLDQTEGMTDAET------LRQRAEIRFLRALHYWYFLDLFGKAPFKEHFSNDLPV
1wfdA           ----------------------------------------------------------------------
2hr2A1          GKERXXEVAIDRIAQL------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           RFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEE
1ddbA           GDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAK-KVASH
1w3bA           GSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYLEVFPEFAAAHSNLASVLQQQGKLQE
1hz4A           HSDWISNANKVR--------VIYWQMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEP
2a5yB3          ----------------------------------------------------------------------
1qsaA1          EEYELKIDKAPQNVDSALTQGPEMARVRELMYWNLDNTARSEWANLVKSKSKTEQAQLARYAFNNQWWDL
1ya0A1          FIKFHGH------------VYLSKSLEKLSPLREKLEEQFKELLFQ-KAFNSQQLVHVTVINLFQLHHLR
1a87A           EKIREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPILAVTALGVIGIMTSYLSSFID
1ihgA1          RAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALY-RRAQGWQGLKEYDQ
1d8dA           LQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRES
2fbnA1          NV--------KALYKLGVANMYFGFLEEAK----ENLYKAASL----NPNNLDIRNSYELCVNKLKEARK
1fchA           -------------------CINLGAHREAVEHFLEALNMQRKSGGAMSENIWS---TLRLALSMLGQSDA
2pqnA1          -------------------STDVNDERLGVKILTDI-------YKEAESRRRECLYYLTIGCYKLGEYSM
2cptA1          ---------------------------------------------SPNLQKAIDLASKAAQEDKAGNYEE
2hr2A1          DHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAE
1ouvA           -------------------SYKEKDFTQAKKYFEKAC--------DLKENSGCFNLGVLYYQGQGVEKNL
1qvrA2          ----------------------------------------------------------------------
3ck7A1          EKKGT------------------ELYTYIQN-----ELNEIEADMYEPRQAPFGRADKAANWLLRARLYL
1wfdA           -------------------LDAESRYQQALVCYQEG-------IDMLLQVLKGTK-ESSKRCVLRTKISG
2hr2A1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           ARVIDERALQVLTDRLGEYHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           APSLLRDVFHTTVNFINQNL--------------------------------------------------
1w3bA           ALMHYKEAIR------------------------------------------------------------
1hz4A           AEIVLEELNEN-----------------------------------------------------------
2a5yB3          ----------------------------------------------------------------------
1qsaA1          SVQATIAGKL------------------------------------------------------------
1ya0A1          DFSNETEQHTYSQDEQLCWT--------------------------------------------------
1a87A           A---------------------------------------------------------------------
1ihgA1          ALADLKKAQE------------------------------------------------------------
1d8dA           DI--------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1fchA           YGAADARDLSTL----------------------------------------------------------
2pqnA1          AKRYVDTLFE------------------------------------------------------------
2cptA1          ALQLYQHAVQYFLHVVKYEA--------------------------------------------------
2hr2A1          AXPEFKKVVEXIEERKGETP--------------------------------------------------
1ouvA           KKAASFYAKA------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
3ck7A1          NAGVYTGQTD------------------------------------------------------------
1wfdA           YMDRAENIKKYLDQEK------------------------------------------------------
2hr2A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ddbA           -----------------------------------------------------
1w3bA           -----------------------------------------------------
1hz4A           -----------------------------------------------------
2a5yB3          -----------------------------------------------------
1qsaA1          -----------------------------------------------------
1ya0A1          -----------------------------------------------------
1a87A           -----------------------------------------------------
1ihgA1          -----------------------------------------------------
1d8dA           -----------------------------------------------------
2fbnA1          -----------------------------------------------------
1fchA           -----------------------------------------------------
2pqnA1          -----------------------------------------------------
2cptA1          -----------------------------------------------------
2hr2A1          -----------------------------------------------------
1ouvA           -----------------------------------------------------
1qvrA2          -----------------------------------------------------
3ck7A1          -----------------------------------------------------
1wfdA           -----------------------------------------------------
2hr2A1          -----------------------------------------------------